SecReT6
Protein ID: 330819528
SecReT6 ID430
T6SS typei3
Gene symbol-
Locus tagbgla_2g04020
StrainBurkholderia gladioli BSR3
Repliconchromosome II [GenBank: NC_015376] [Browse all T6SS(s) in this replicon]
Location [Strand]507039..508448 [+]
Producttype IV / VI secretion system protein, DotU family
NoteTssL
UniProt IDF2LJL1
KEGG IDbgd:bgla_2g04020
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-64, Aligned region: 87..290
OmpA [PF00691], Evalue: 5.30E-12, Aligned region: 360..459
Protein Sequence: 469 a.a.     [Download]
>gi|330819528|ref|YP_004348390.1| type IV / VI secretion system protein, DotU family [Burkholderia gladioli BSR3]
MSEDNRRDDRASRVDATVLRPQGSSGSGSGSDDVTRIMAPRAAGADAGATVISGGAYAAAAGQGGARSAP
RPALRAELGDFMSGVANPLVRAANPLLLLTVQLRHSVAPPADVARLREQAVAQVHSFESYAQGAGINTQT
IMAARYVLCTMLDESVNNAPWGELSGWAQKTLLVTFHGETYGGAKFFQILDRLSVDFSRHLDLIELMYIC
LALGFGGRYLVEPGGLGRLADIQDDLYRRIRGLREAPAAELAPHWRGVEDRRNPVMRHVPLWVAMAAAAV
ILLASFLYFFTRLNGLVEPVSAQLAAIGLQNVPPPQANAAPKPAGKSLKSLLAPLEQAGALAVDEQPDGR
ATVRLAAGLLFPSGGADIAPAEIPLLRQVAAALNQVKGRVIVVGHTDDQPIRSLKFKDNFALSTARAQNT
LAILAQGLDDPRRLEANGAGSSQPIATPPSLPENRARNRRVEILYIPEN
 
Nucleotide Sequence: 1410 bp     [Download]
>gi|330819133|ref|NC_015376.1|:507039-508448 Burkholderia gladioli BSR3 chromosome 2, complete sequence
ATGAGCGAAGACAACCGCAGGGACGATCGCGCGTCGCGCGTCGACGCCACCGTGCTGCGCCCGCAAGGCA
GCAGCGGCTCGGGTTCCGGCTCCGACGACGTGACCCGCATCATGGCGCCGCGCGCGGCCGGCGCCGATGC
CGGCGCGACGGTGATCTCCGGCGGCGCTTATGCGGCGGCGGCCGGGCAGGGCGGCGCGCGTTCCGCCCCG
CGCCCCGCGCTGCGCGCCGAGCTCGGCGACTTCATGAGCGGTGTGGCCAATCCGCTGGTGCGCGCGGCCA
ATCCGCTGCTGCTGCTGACCGTGCAGCTTCGCCACAGCGTCGCGCCGCCGGCCGACGTGGCGCGCCTGCG
CGAGCAGGCGGTGGCCCAGGTGCACAGCTTCGAGAGCTACGCGCAGGGCGCCGGCATCAACACCCAGACC
ATCATGGCCGCGCGCTACGTGCTCTGCACCATGCTCGACGAGTCCGTCAACAACGCGCCCTGGGGCGAGC
TGAGCGGCTGGGCGCAGAAGACCCTGCTGGTCACCTTCCACGGCGAGACCTACGGCGGCGCGAAGTTCTT
CCAGATCCTCGATCGCCTGAGCGTCGACTTCTCGCGTCATCTCGACCTGATCGAGCTGATGTACATCTGC
CTGGCGCTCGGCTTCGGCGGGCGCTACCTGGTCGAGCCGGGCGGCCTGGGGCGCCTGGCCGACATCCAGG
ACGACCTGTACCGCCGTATCCGCGGCCTGCGCGAGGCGCCGGCCGCCGAGCTCGCGCCGCACTGGCGCGG
CGTGGAGGATCGCCGCAACCCGGTGATGCGCCACGTGCCGCTGTGGGTGGCGATGGCCGCCGCCGCGGTG
ATCCTGCTGGCCAGCTTCCTCTACTTCTTCACGCGCCTGAACGGCCTGGTGGAGCCGGTCAGCGCGCAGC
TTGCCGCGATCGGCCTGCAGAACGTGCCGCCGCCGCAGGCCAACGCCGCGCCCAAGCCGGCCGGCAAGAG
CCTGAAGTCGCTGCTCGCGCCGCTCGAGCAGGCCGGCGCGCTGGCCGTCGACGAGCAGCCCGACGGCCGC
GCCACGGTGCGCCTGGCCGCGGGCCTGCTGTTCCCCTCGGGCGGCGCCGACATCGCGCCGGCCGAGATAC
CGCTGCTGCGCCAGGTGGCGGCCGCGCTGAACCAGGTGAAGGGCCGCGTGATCGTGGTCGGCCATACCGA
CGACCAGCCGATCCGCTCGCTGAAGTTCAAGGACAACTTCGCGCTGTCCACGGCGCGCGCCCAGAACACG
CTGGCGATCCTGGCCCAGGGCCTGGACGATCCGCGCCGCCTGGAAGCGAACGGCGCCGGCTCCTCGCAGC
CGATCGCCACGCCGCCGAGCCTGCCGGAGAACCGGGCGCGCAATCGCCGCGTGGAAATCCTCTACATCCC
GGAGAACTGA