SecReT6
Protein ID: 330819534
SecReT6 ID430
T6SS typei3
Gene symbol-
Locus tagbgla_2g04080
StrainBurkholderia gladioli BSR3
Repliconchromosome II [GenBank: NC_015376] [Browse all T6SS(s) in this replicon]
Location [Strand]517880..518953 [-]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDF2LJL7
KEGG IDbgd:bgla_2g04080
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.70E-25, Aligned region: 58..118
ImpA-rel_N [PF06812], Evalue: 7.70E-25, Aligned region: 162..168
Protein Sequence: 357 a.a.     [Download]
>gi|330819534|ref|YP_004348396.1| type VI secretion-associated protein, ImpA family [Burkholderia gladioli BSR3]
MTHSDSTDPNPLLAAIDDAAPTGPDLEYDPAFTDLERIAMPTPERAMGDSLKAAQEPDWDKVAQAAEALF
ARTKDLRVAVHLTAARTRRQGLAGWASGLALVRELLERYWDDVHPRLDAEDDNDPTARVNAVMPLGDPQG
TLAYFRVVPFVQSPRLGRFSLRDLRVATGAITAAPSPDGSPPPTLVDLEACCLDCPEEQLPESAALLAAA
QDHANALIALLRERLGTASPDFGLLAADIAELRKFVDAQLLRRFPERAAELAAAAQADGADGEIPADMAA
AAAAVAPPPGKISGHDDVIRRLDEICEYYERIEPSSPLPILLKRARRLVGKSFVEVLRDIAPGGLSELQT
LSGPEAD
 
Nucleotide Sequence: 1074 bp     [Download]
>gi|330819133|ref|NC_015376.1|:c518953-517880 Burkholderia gladioli BSR3 chromosome 2, complete sequence
ATGACCCATTCCGACTCGACCGACCCGAACCCGCTGCTCGCCGCGATCGACGACGCGGCGCCCACCGGCC
CCGATCTCGAATACGACCCCGCCTTCACCGATCTCGAGCGGATCGCCATGCCCACCCCCGAGCGCGCCAT
GGGCGACAGCCTGAAGGCCGCCCAGGAGCCCGACTGGGACAAGGTCGCGCAAGCGGCCGAGGCGCTGTTC
GCGCGCACCAAGGACCTGCGCGTGGCCGTGCACCTGACCGCCGCGCGCACGCGCCGCCAGGGCCTGGCGG
GCTGGGCCTCGGGCCTGGCCCTGGTGCGCGAGCTGCTGGAGCGCTACTGGGACGACGTGCATCCCCGGCT
CGACGCCGAGGACGACAACGACCCGACCGCGCGCGTCAACGCGGTGATGCCGCTGGGCGACCCGCAGGGC
ACGCTGGCCTATTTCCGCGTGGTGCCCTTCGTGCAGTCGCCGCGGCTCGGCCGCTTCTCGCTGCGCGACC
TGCGCGTGGCGACCGGCGCGATCACCGCCGCGCCCTCGCCCGACGGCTCGCCGCCGCCGACCCTGGTCGA
CCTGGAAGCCTGCTGCCTCGACTGCCCCGAGGAGCAGTTGCCGGAATCGGCCGCGCTGCTGGCCGCCGCG
CAGGATCACGCCAACGCGCTGATTGCCCTGCTGCGCGAGCGGCTCGGCACCGCGAGCCCCGATTTCGGGC
TGCTGGCCGCGGATATCGCCGAGCTGAGGAAATTCGTCGATGCCCAGTTGTTGCGGCGCTTTCCCGAGCG
CGCGGCCGAGCTGGCCGCCGCCGCGCAGGCGGACGGCGCCGACGGCGAGATACCGGCCGATATGGCAGCG
GCAGCCGCGGCCGTGGCACCGCCGCCCGGCAAGATCTCGGGCCACGACGACGTGATCCGCCGCCTCGACG
AGATCTGTGAGTATTACGAACGAATCGAGCCGTCCAGCCCGCTGCCGATCCTGCTCAAGCGCGCGCGGCG
CCTGGTCGGCAAGAGCTTCGTCGAGGTCCTGCGGGATATCGCGCCGGGCGGGCTGTCGGAGTTGCAGACG
CTGTCGGGGCCCGAGGCCGATTGA