SecReT6
Protein ID: 332161210
SecReT6 ID427
T6SS typei3
Gene symbol-
Locus tagYE105_C1588
StrainYersinia enterocolitica subsp. palearctica 105.5R(r)
Repliconchromosome [GenBank: NC_015224] [Browse all T6SS(s) in this replicon]
Location [Strand]1859057..1860220 [-]
Producthypothetical protein
NoteTssA
UniProt IDF0KS29
KEGG IDyep:YE105_C1588
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.90E-16, Aligned region: 62..121
Protein Sequence: 387 a.a.     [Download]
>gi|332161210|ref|YP_004297787.1| hypothetical protein YE105_C1588 [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
MSVHSIADSRGYYHRLMQPIPGDHPCGLSLEYDSAFLMLQTKLQPKLTAEYGNFVEVAEPTNWTDTERKC
LELLGKARDIRLLIILMRCRMRQIGVSAVQEGLEALLWCLSTWPDDLHPQLLDEGEFEPFMRANAFAELD
DIDGFIADFRNQPLPKAAGMQISVKELEKAHSFPREEGALEEATLEAIEHDWQARSDNAILSLQKAYALL
LELTTRLSHSLGDVTPDFVRLTAVLRLFGGSNMADIAPIAAFETPEYITATEATEVYTTAPEWQPEEIVT
AVSVPTDTATPTYPPAPHMSPLQQLPLQSPPPIAVAAQVPIAPKGIQNRADALSRLIEVRQWFATTEPSS
PVIALLSFSEKTIGKSFGELLQIIPPELISKLDAGQE
 
Nucleotide Sequence: 1164 bp     [Download]
>ref|NC_015224.1|:c1860220-1859057 hypothetical protein YE105_C1588 [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
ATGAGTGTACATAGTATCGCTGATAGCAGAGGTTATTATCACCGCCTGATGCAACCTATTCCAGGTGACC
ATCCTTGCGGCCTAAGTCTGGAATATGACTCAGCATTTCTGATGCTGCAAACAAAACTGCAACCCAAGTT
GACCGCCGAGTACGGCAACTTTGTTGAAGTCGCTGAGCCTACCAACTGGACCGATACCGAGCGAAAATGC
CTGGAGCTGCTAGGTAAAGCCCGTGACATTCGGTTACTGATTATTCTGATGCGCTGTCGAATGCGTCAAA
TTGGCGTAAGTGCGGTGCAGGAAGGGCTGGAAGCACTACTGTGGTGCCTGAGTACCTGGCCGGATGATCT
ACATCCACAGTTACTTGATGAAGGCGAATTTGAACCTTTTATGCGGGCCAATGCTTTTGCAGAATTAGAC
GATATCGATGGTTTTATTGCTGATTTTCGCAACCAACCCCTGCCCAAAGCCGCAGGAATGCAAATATCAG
TCAAAGAGCTTGAGAAAGCGCATTCGTTCCCGCGCGAAGAAGGTGCATTGGAAGAAGCCACTTTGGAAGC
CATTGAACATGATTGGCAGGCCCGTTCCGATAACGCGATCCTCTCATTGCAAAAAGCTTATGCATTGTTG
TTGGAATTAACCACACGTCTTAGCCATTCTCTCGGTGATGTCACCCCTGACTTCGTCAGATTGACTGCGG
TGTTACGCCTCTTTGGTGGGAGCAATATGGCCGATATCGCGCCTATCGCAGCCTTTGAAACACCTGAATA
TATTACGGCAACCGAGGCCACTGAAGTCTATACAACGGCCCCGGAGTGGCAGCCTGAGGAAATAGTCACC
GCGGTCAGTGTACCCACTGATACTGCGACTCCCACTTATCCCCCCGCGCCACACATGTCACCATTACAAC
AACTACCATTGCAATCGCCACCGCCGATAGCTGTTGCGGCGCAAGTTCCAATCGCGCCAAAAGGCATTCA
AAATCGCGCGGACGCGTTATCCCGACTCATTGAAGTCCGCCAATGGTTTGCGACTACCGAGCCTAGCAGC
CCGGTGATTGCGCTATTGTCATTTTCAGAAAAAACCATTGGCAAAAGCTTTGGTGAATTACTGCAAATCA
TTCCGCCAGAACTGATTTCTAAACTTGATGCAGGACAGGAGTAG