SecReT6
Protein ID: 332161211
SecReT6 ID427
T6SS typei3
Gene symbol-
Locus tagYE105_C1589
StrainYersinia enterocolitica subsp. palearctica 105.5R(r)
Repliconchromosome [GenBank: NC_015224] [Browse all T6SS(s) in this replicon]
Location [Strand]1860298..1861323 [-]
Producthypothetical protein
NoteTssG
UniProt IDF0KS30
KEGG IDyep:YE105_C1589
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.40E-90, Aligned region: 21..321
Protein Sequence: 341 a.a.     [Download]
>gi|332161211|ref|YP_004297788.1| hypothetical protein YE105_C1589 [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
MQPDDNIQQQNQLNLDTWYQQAEPWNAGFISMMRANAARTPDMPAPAKAMLPKQETFRIGQSANMAFSPR
EIAHVEMKDGKMDLQLFGLGIWGPHGAMPLQMTELAYTRAELHDHTLTDFADLFHHRALSQLYRAWFVSQ
DTASLDRQHDEKFSFYIGSLVGLDPAELTHSALPVHAHLASSAHLIREARNPEGLVGALQYYFEVPVSMV
EYAQQWIFLDKSDQTQLGDGASAMLLGDGAILGDTVLDRQHKFELILGPLSLQQYLRFSPSGQDLPVLRE
WVRNFVGFEYAWEVQLLLTAAEVPTATLEGTSQLGYTSWLAREDVSANVRGMSFEPEMHLY
 
Nucleotide Sequence: 1026 bp     [Download]
>ref|NC_015224.1|:c1861323-1860298 hypothetical protein YE105_C1589 [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
ATGCAACCCGATGACAACATACAGCAACAGAACCAACTCAATCTGGATACCTGGTATCAGCAAGCAGAGC
CATGGAATGCCGGTTTTATCAGCATGATGCGGGCTAATGCGGCCCGAACTCCCGATATGCCCGCTCCCGC
TAAAGCTATGCTGCCGAAACAGGAAACCTTTCGTATCGGGCAAAGTGCCAATATGGCGTTCTCACCACGT
GAGATAGCCCATGTTGAAATGAAAGACGGGAAGATGGACCTACAGCTTTTTGGTCTGGGTATCTGGGGGC
CGCACGGCGCGATGCCGTTGCAAATGACTGAACTGGCCTACACTCGCGCTGAGTTGCATGACCATACACT
GACCGACTTTGCCGATCTATTTCATCATCGGGCGCTATCACAGCTCTATCGCGCATGGTTTGTCTCTCAG
GACACCGCTTCGCTTGACAGGCAACATGATGAGAAATTCTCTTTTTATATCGGCAGCCTGGTCGGTTTAG
ACCCAGCGGAGCTGACACATAGTGCGCTGCCGGTGCATGCTCATCTGGCTTCATCCGCCCATCTTATTCG
TGAAGCACGTAACCCCGAAGGCTTAGTCGGCGCATTGCAATACTACTTTGAAGTGCCGGTCAGCATGGTC
GAATACGCCCAACAGTGGATCTTTCTGGATAAAAGTGACCAGACGCAATTGGGCGATGGTGCCTCGGCGA
TGCTGTTAGGTGACGGTGCCATTCTGGGCGACACCGTTTTAGACCGACAGCATAAGTTTGAGCTGATACT
TGGCCCGCTCAGCCTGCAACAGTATTTGCGTTTCAGCCCATCAGGACAGGATTTACCGGTATTACGTGAA
TGGGTTCGTAACTTTGTCGGATTTGAATATGCCTGGGAAGTGCAGTTGTTGTTAACCGCCGCTGAGGTTC
CTACCGCCACATTGGAGGGCACCAGCCAGTTGGGGTACACCAGTTGGTTAGCCCGAGAGGATGTCTCAGC
CAACGTACGCGGAATGAGTTTTGAACCCGAAATGCACCTTTATTAA