SecReT6
Protein ID: 332161212
SecReT6 ID427
T6SS typei3
Gene symbol-
Locus tagYE105_C1590
StrainYersinia enterocolitica subsp. palearctica 105.5R(r)
Repliconchromosome [GenBank: NC_015224] [Browse all T6SS(s) in this replicon]
Location [Strand]1861323..1863158 [-]
Producthypothetical protein
NoteTssF
UniProt IDF0KS31
KEGG IDyep:YE105_C1590
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.50E-197, Aligned region: 1..610
Protein Sequence: 611 a.a.     [Download]
>gi|332161212|ref|YP_004297789.1| hypothetical protein YE105_C1590 [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
MREMAQEFADKHPKIAGRLGMHGIEVADPYVERLIESFCFLSARTQIKLDAEFPKFTQRLLDIVYPNYNS
PTPSMGVIQLKPNLKEGDLTQGYNVPRGSSFFTHIAPGETTRCEFRSGQDVGLWPLEITEARLSSIPPDM
PNLEKHRIAYHRLKGALRIKLKLVGDLQFSQLAGLDRLPIYINGDERIVSHIFELLHASHVATIIRAGHG
VTAEDTVISNDALAFEGLSPDQSLLPLSWNIFHGHNLMQEYFTCRQRFYFFTLTQLSKSLSNNHTNEAEI
IILLDRLPQELVSHVAPSRFLLNCTPVINLFQKRMDKIEINRALNDFHVVPDRSRPLDYEVFSITKVFGQ
QAETSKEVVFNPLYQTRHCDNGNFGRYFSITRKPRTSQNNKRKYDTRTPYASTEVFVSLVDQQEAPYGDN
LRYLSIEAQVTNRDLPRLITSNGNFELTMSDSAPVHGAHFVFQPSPPRAPFAIDESAWRLIRQLSFNYLP
LSDMTHANGGESLRNMLRLFVSASDLESNTQIDALVGCKSEPVIRRLPGNGLLVYGRGICCTLTVDEEGF
SGISPYLFGLIMENYLARHAAINVFTETELHSMQRGRVGQWKARPGRRGVL
 
Nucleotide Sequence: 1836 bp     [Download]
>ref|NC_015224.1|:c1863158-1861323 hypothetical protein YE105_C1590 [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
ATGCGTGAAATGGCGCAGGAATTCGCAGATAAGCATCCTAAAATAGCGGGCCGCTTAGGCATGCATGGGA
TTGAAGTTGCCGACCCCTATGTCGAACGCCTGATCGAGTCTTTCTGCTTTCTCTCTGCCAGAACACAAAT
TAAGCTGGATGCCGAATTCCCTAAATTTACTCAGCGCTTGCTGGATATTGTCTATCCCAATTACAACTCT
CCCACCCCTTCAATGGGAGTGATTCAACTTAAGCCAAACCTAAAAGAGGGTGATCTGACTCAGGGCTATA
ATGTCCCTCGTGGCAGTTCGTTTTTCACCCATATTGCCCCAGGTGAAACGACCCGTTGTGAATTTCGCAG
TGGGCAGGATGTTGGATTATGGCCGCTGGAGATAACAGAAGCGCGCCTAAGCTCCATTCCTCCCGATATG
CCTAATCTGGAAAAGCACCGTATTGCCTATCATCGACTAAAGGGTGCCTTGCGCATTAAGCTAAAACTGG
TCGGCGACCTGCAATTTTCGCAACTAGCAGGGTTAGATCGCCTGCCTATCTATATCAATGGTGACGAGAG
GATAGTCTCTCACATCTTTGAACTTCTGCATGCCAGCCATGTTGCAACTATCATCCGCGCAGGGCACGGC
GTGACAGCTGAAGATACCGTGATAAGCAATGACGCTCTTGCTTTTGAGGGGTTAAGCCCTGATCAAAGCC
TGTTGCCACTGTCGTGGAATATTTTTCATGGCCATAACCTGATGCAGGAATACTTCACCTGCCGCCAGCG
ATTCTATTTTTTCACACTGACTCAGTTGTCCAAAAGTCTAAGCAATAATCACACCAACGAAGCGGAGATT
ATTATCTTACTGGACCGGTTGCCACAGGAGCTGGTGAGTCATGTTGCCCCCTCTCGCTTCCTATTGAACT
GCACCCCGGTGATTAATCTATTCCAGAAGCGCATGGACAAGATTGAGATTAATCGTGCACTGAATGACTT
TCACGTGGTGCCAGACCGAAGCCGACCGCTCGATTACGAAGTTTTCTCCATCACGAAAGTCTTTGGTCAA
CAAGCGGAAACCAGTAAAGAGGTGGTATTTAACCCCCTCTACCAAACCCGCCATTGCGACAATGGCAATT
TTGGTCGTTATTTTTCCATTACCCGTAAGCCCAGAACGAGTCAGAATAATAAGCGTAAATATGACACCCG
TACGCCTTATGCCAGTACGGAGGTCTTCGTTTCGCTGGTTGATCAACAAGAAGCGCCCTACGGAGATAAC
CTGCGGTATTTATCCATTGAGGCGCAGGTGACTAACCGAGATCTGCCGCGGTTGATTACCAGTAATGGCA
ATTTTGAATTAACCATGTCGGATTCAGCTCCAGTACACGGCGCGCACTTTGTATTTCAGCCCAGCCCCCC
TCGGGCCCCTTTTGCGATAGATGAATCTGCCTGGCGGTTAATCCGTCAGCTCAGTTTTAACTACTTGCCA
CTATCCGATATGACTCATGCAAATGGGGGGGAGTCGCTACGTAACATGCTGCGTCTGTTTGTTAGCGCCT
CAGATCTTGAGTCGAATACCCAAATCGATGCACTGGTTGGCTGCAAAAGTGAGCCGGTAATCAGACGACT
ACCCGGTAATGGCTTACTGGTTTATGGTCGTGGGATCTGTTGCACCCTGACCGTTGATGAAGAAGGGTTC
TCAGGTATCAGCCCCTATCTGTTTGGCTTGATCATGGAAAACTATTTGGCACGCCACGCCGCGATCAATG
TGTTTACCGAGACTGAACTGCACTCGATGCAAAGAGGACGTGTCGGTCAGTGGAAAGCCCGTCCTGGTCG
CCGGGGAGTGCTGTAA