SecReT6
Protein ID: 332161219
SecReT6 ID427
T6SS typei3
Gene symbol-
Locus tagYE105_C1597
StrainYersinia enterocolitica subsp. palearctica 105.5R(r)
Repliconchromosome [GenBank: NC_015224] [Browse all T6SS(s) in this replicon]
Location [Strand]1872240..1873736 [+]
Producthypothetical protein
NoteTssC
UniProt IDF0KS38
KEGG IDyep:YE105_C1597
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.40E-193, Aligned region: 66..492
Protein Sequence: 498 a.a.     [Download]
>gi|332161219|ref|YP_004297796.1| hypothetical protein YE105_C1597 [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
MSTLEAKNKPAAAATEYSDFNSLLTKEFKAKSEQTKAAVEGAVKTLAEQALANSVTVSDDAYKSIASIIA
EIDSKLSEQINLILHHQEFQSLESAWRGLHYLVNNTETDEKLRLRFLDISKDELRRNMKRYKGVAWDQSP
LFKKVYEEEYGQLGGEPYGCLVADYYFDHTAPDVDLLASIGKVAASAHVPFITGAAPSVLQMESWQELSN
PRDLTKIFTQNLEYAAWNSLRQSEDSRYIGLAMPRFLARLPYGIRTNPVDAFHFEETTDGADHGKYVWSN
AAYAMAVNINRSFKEYGWCTLIRGVESGGVVEGLPCHTFPTDDGGIDMKCPTEIAISDRREAELAKNGFI
PLVHRKNTDYAAFIGAQSLQKPAEYYDSDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERDEM
QRWLNDWVMNYVDGDPANSSIETKARRPLAAAEVIVEDVEGNPGYYQAKFFLRPHFQLEGLTVSLRMVAK
LPSLKDVA
 
Nucleotide Sequence: 1497 bp     [Download]
>ref|NC_015224.1|:1872240-1873736 hypothetical protein YE105_C1597 [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
ATGTCCACTTTAGAAGCAAAAAATAAACCAGCCGCTGCTGCGACTGAATATAGCGACTTTAATTCGTTAT
TGACCAAAGAATTCAAGGCTAAGTCTGAGCAGACCAAAGCGGCAGTAGAAGGTGCCGTTAAAACATTGGC
TGAGCAGGCGCTGGCTAACTCGGTAACTGTATCTGATGATGCTTATAAAAGCATTGCCTCTATTATTGCT
GAGATCGACAGTAAATTGTCTGAGCAGATCAATTTGATCTTGCATCATCAAGAGTTTCAGTCTCTGGAAA
GTGCCTGGCGTGGCCTGCACTATTTAGTGAATAACACCGAGACTGATGAGAAATTGAGATTACGTTTTCT
CGACATCTCTAAAGATGAATTACGCCGTAATATGAAGCGTTATAAAGGTGTGGCGTGGGATCAGAGCCCA
TTATTCAAAAAAGTCTATGAAGAAGAGTACGGCCAATTGGGCGGCGAACCTTATGGTTGCCTGGTGGCGG
ATTACTACTTTGACCATACTGCGCCTGACGTTGATTTGCTGGCTTCCATCGGTAAGGTTGCTGCTTCTGC
ACACGTACCTTTTATCACTGGTGCCGCGCCGTCAGTATTGCAGATGGAATCCTGGCAAGAGCTGTCAAAT
CCGCGTGATTTGACCAAGATCTTCACTCAGAATCTTGAGTATGCTGCCTGGAACTCACTGCGTCAGTCCG
AAGACTCCCGTTATATTGGCCTAGCAATGCCGCGTTTCCTGGCGCGTCTGCCATACGGTATTCGCACTAA
CCCGGTAGATGCCTTCCACTTTGAAGAGACGACTGACGGTGCCGACCACGGCAAATATGTGTGGTCCAAC
GCGGCGTATGCTATGGCTGTTAACATCAACCGTTCATTCAAAGAATACGGCTGGTGTACCCTGATTCGTG
GTGTGGAAAGTGGTGGTGTGGTGGAAGGCTTGCCATGTCATACATTCCCAACTGATGATGGTGGCATTGA
TATGAAGTGCCCAACAGAAATCGCTATTTCTGACCGTCGTGAAGCGGAATTGGCTAAAAATGGCTTTATT
CCACTGGTGCACAGAAAAAATACTGATTATGCGGCATTTATTGGCGCGCAATCATTGCAAAAACCTGCTG
AATATTACGATTCAGATGCTACAGCTAACGCTAACTTGTCGGCGCGTTTGCCGTACCTGTTCGCCTGTTC
ACGTTTTGCCCATTACCTGAAATGTATCGTGCGTGACAAAATCGGCTCATTCAAAGAGCGCGATGAGATG
CAACGCTGGTTGAACGATTGGGTCATGAACTATGTAGATGGTGATCCGGCAAACTCTTCTATCGAGACTA
AAGCACGCCGTCCGTTGGCCGCAGCTGAAGTTATTGTTGAAGATGTTGAAGGTAACCCAGGTTATTACCA
GGCTAAATTCTTCCTGCGCCCACACTTCCAATTGGAAGGTTTGACGGTATCACTGCGCATGGTTGCTAAA
TTACCTTCACTGAAAGATGTTGCGTAA