SecReT6
Protein ID: 332161220
SecReT6 ID427
T6SS typei3
Gene symbol-
Locus tagYE105_C1598
StrainYersinia enterocolitica subsp. palearctica 105.5R(r)
Repliconchromosome [GenBank: NC_015224] [Browse all T6SS(s) in this replicon]
Location [Strand]1874075..1874560 [+]
Producthypothetical protein
NoteTssD
UniProt IDF0KS39
KEGG IDyep:YE105_C1598
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.20E-43, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|332161220|ref|YP_004297797.1| hypothetical protein YE105_C1598 [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
MSQDMFIKIDGIEGESLDANHKNEIQVLAWKWDVSQHSNMHSGSGGGSGKATVSDFCFTHYIDKASPNLL
SYCLLGKHIKNIQFVLRKAGGDPLEYLTIKFTDVIITRVDMAGSLEDETRPREEIRFSFTKMTQDYVMQN
AEGHKSGVISANYDVKANQQS
 
Nucleotide Sequence: 486 bp     [Download]
>ref|NC_015224.1|:1874075-1874560 hypothetical protein YE105_C1598 [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
ATGTCGCAAGATATGTTTATTAAAATTGATGGTATCGAAGGCGAATCTTTAGATGCTAACCACAAAAACG
AAATTCAGGTGCTGGCTTGGAAATGGGACGTTTCTCAGCACTCAAATATGCACAGTGGCTCAGGCGGTGG
TTCAGGTAAAGCAACTGTTTCTGACTTCTGTTTCACGCATTATATCGATAAAGCAAGCCCGAACTTATTG
AGCTATTGCTTGTTGGGTAAGCATATTAAGAATATCCAATTCGTTCTGCGTAAAGCAGGTGGCGATCCAC
TGGAATACCTGACTATTAAATTTACCGATGTAATCATCACTCGTGTTGATATGGCCGGTTCTCTTGAAGA
TGAAACTCGTCCACGTGAAGAAATTCGTTTCTCATTCACCAAGATGACTCAAGACTACGTTATGCAGAAT
GCTGAAGGCCATAAATCTGGCGTTATTTCTGCTAACTACGATGTTAAAGCTAACCAGCAAAGCTAA