SecReT6
Protein ID: 332161221
SecReT6 ID427
T6SS typei3
Gene symbol-
Locus tagYE105_C1599
StrainYersinia enterocolitica subsp. palearctica 105.5R(r)
Repliconchromosome [GenBank: NC_015224] [Browse all T6SS(s) in this replicon]
Location [Strand]1874782..1875318 [+]
Producthypothetical protein
NoteTssJ
UniProt IDF0KS40
KEGG IDyep:YE105_C1599
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 8.70E-35, Aligned region: 22..172
Cag12 [PF13117], Evalue: 0.0083, Aligned region: 20..49
Protein Sequence: 178 a.a.     [Download]
>gi|332161221|ref|YP_004297798.1| hypothetical protein YE105_C1599 [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
MKKNIRWFNRITQYFFVALVTLLVMACSSKPKPEPVDKLSVELTTAKNINPNDKGVANPLRITVYTLKNT
DEFKSSDFFTITEEGTPSLKEQMEKVFDGIMLPNETKTIELTLNSGVTAIGVVAAYREIEQAEWNAVFSP
LPKKRVQPWYKKWWSGKQNEPVVKVRVERRSISIKEMD
 
Nucleotide Sequence: 537 bp     [Download]
>ref|NC_015224.1|:1874782-1875318 hypothetical protein YE105_C1599 [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
ATGAAAAAAAATATCCGTTGGTTTAATCGGATTACACAATACTTTTTCGTGGCATTGGTCACGCTATTGG
TCATGGCATGTAGCTCGAAGCCTAAACCCGAACCGGTTGATAAATTGAGCGTCGAGCTGACTACGGCAAA
AAATATCAATCCAAATGACAAAGGTGTCGCTAATCCGTTAAGGATCACAGTTTATACCCTGAAGAATACG
GATGAATTTAAGTCGAGTGACTTCTTCACTATTACCGAAGAGGGTACTCCATCTCTGAAAGAGCAGATGG
AGAAAGTGTTTGACGGAATCATGCTACCTAATGAGACAAAAACAATAGAACTGACGCTAAACAGTGGCGT
CACTGCCATCGGCGTCGTTGCTGCTTACCGTGAAATTGAGCAGGCGGAGTGGAACGCGGTTTTTAGCCCG
TTACCCAAGAAACGCGTGCAGCCCTGGTATAAAAAATGGTGGTCAGGGAAACAAAACGAACCGGTAGTCA
AGGTGCGCGTTGAGCGTCGGTCAATATCAATCAAAGAAATGGACTAA