SecReT6
Protein ID: 332161222
SecReT6 ID427
T6SS typei3
Gene symbol-
Locus tagYE105_C1600
StrainYersinia enterocolitica subsp. palearctica 105.5R(r)
Repliconchromosome [GenBank: NC_015224] [Browse all T6SS(s) in this replicon]
Location [Strand]1875322..1876671 [+]
Producthypothetical protein
NoteTssK
UniProt IDF0KS41
KEGG IDyep:YE105_C1600
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.00E-143, Aligned region: 19..447
Protein Sequence: 449 a.a.     [Download]
>gi|332161222|ref|YP_004297799.1| hypothetical protein YE105_C1600 [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
MRTNKVVWSEGLFLRPQLFQQQERYLEYYAHKRAATITPFFWGFAQYEIDREALSYGKLVLRSGKGVLPD
GTPFDIPGHAELPEPLTITPDHLGKLIYLAVPLRLDNSDETIFDEYDMSSLARFYAYEADLSDTNAIRQG
PKPVQLSRLRLKLVSESEMTESWIGLPLAKVRAIQPDGSVLLHLEDYIPPVTGYAASSLLSEWLTHLNGL
VKMRADMLAKRLSNSDGKASASAEIVDYLLLQIFNKYEPSLDHLRNIPELPPIVLYQELAKFAGELSTFI
RTKTRRPRPAPGYDHGKLYPSIRPLVDDVHELLNQILVRAGQMIPLDPKGNGVWSASVLPNELRSFSNLV
LAVHAQLPMDVLQHQFSVQTKISAPQQLHELVRSHLPGLELQRLPVPPRQIPYSAGYVYFELMKSGPFWD
KVSNAGAIALHVAGDFPALKMELWGIRDS
 
Nucleotide Sequence: 1350 bp     [Download]
>ref|NC_015224.1|:1875322-1876671 hypothetical protein YE105_C1600 [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
GTGAGAACTAATAAAGTCGTTTGGAGTGAGGGTCTTTTTCTTCGCCCGCAACTTTTTCAACAGCAAGAGC
GGTATCTTGAATATTACGCTCATAAACGAGCCGCCACGATTACCCCATTCTTTTGGGGATTCGCACAATA
TGAAATTGATCGCGAAGCGCTCTCCTATGGCAAGTTGGTACTGCGATCTGGCAAAGGAGTATTACCGGAC
GGTACGCCTTTTGATATTCCCGGTCATGCTGAACTGCCTGAGCCACTTACCATCACCCCAGATCATTTGG
GCAAACTAATCTATCTGGCGGTTCCGTTGCGGCTGGATAACAGTGATGAAACTATTTTTGACGAATATGA
CATGAGCTCATTGGCGCGTTTTTATGCCTATGAAGCAGACCTCAGTGACACTAATGCTATTCGCCAGGGG
CCGAAGCCGGTGCAGTTGTCGCGGCTGCGGCTTAAATTGGTTTCTGAAAGCGAAATGACCGAATCATGGA
TTGGGTTGCCACTGGCCAAAGTCAGGGCGATTCAGCCTGATGGTAGCGTACTGCTGCATCTGGAAGACTA
CATTCCTCCGGTGACGGGATATGCGGCGAGTTCACTGCTGTCAGAGTGGCTGACCCATCTTAATGGCTTG
GTCAAAATGCGTGCCGATATGCTGGCTAAACGTCTGTCAAACAGTGATGGCAAAGCTAGCGCCAGTGCTG
AAATTGTCGACTATTTGCTGCTGCAAATTTTTAATAAATACGAGCCAAGTCTGGATCATCTGCGCAATAT
TCCAGAATTACCGCCAATCGTGCTTTATCAAGAACTTGCCAAGTTTGCCGGTGAATTATCCACCTTCATT
CGGACCAAAACGCGTCGGCCGCGCCCGGCTCCGGGATATGACCACGGGAAACTCTACCCGTCGATTCGCC
CATTGGTGGACGATGTGCATGAATTGCTCAATCAGATTCTGGTGCGTGCAGGGCAGATGATCCCGTTGGA
CCCAAAAGGGAATGGCGTATGGTCTGCCTCTGTGCTGCCTAATGAATTACGTTCATTTTCCAATTTGGTA
TTGGCTGTTCATGCACAATTACCAATGGACGTATTGCAGCATCAATTCTCAGTACAGACCAAAATCAGCG
CGCCACAACAGTTGCATGAACTGGTGCGCTCACATTTACCGGGTCTCGAATTACAGCGGTTGCCGGTTCC
ACCGCGGCAAATTCCGTACAGTGCGGGATACGTTTATTTCGAATTGATGAAAAGCGGGCCGTTTTGGGAC
AAAGTTTCTAATGCAGGGGCCATTGCACTACACGTGGCTGGCGATTTCCCTGCGTTGAAAATGGAACTCT
GGGGGATTAGAGATTCATGA