SecReT6
Protein ID: 332161223
SecReT6 ID427
T6SS typei3
Gene symbol-
Locus tagYE105_C1601
StrainYersinia enterocolitica subsp. palearctica 105.5R(r)
Repliconchromosome [GenBank: NC_015224] [Browse all T6SS(s) in this replicon]
Location [Strand]1876668..1878044 [+]
Productputative OmpA family protein
NoteTssL
UniProt IDF0KS42
KEGG IDyep:YE105_C1601
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.90E-55, Aligned region: 86..291
OmpA [PF00691], Evalue: 4.30E-17, Aligned region: 352..450
Protein Sequence: 458 a.a.     [Download]
>gi|332161223|ref|YP_004297800.1| putative OmpA family protein [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
MSDSSELNPGIPMPSFDQSRDADTNPQALGHFLLDEPSVYTESTQSGAAFSHEATRSPGFQPYDTAQLRG
ESVQQRVAKAVASPTPLLEAAQPLLRALSEMPQEIADASQVQILKESLKNEITLFSVVCDEADISWKKMA
IVRYCLCTALDEAAHTMSWGVMSGWSQSNLLNHFEGDNDGGNKFFLLVGRLSMSPHEYADCLEVLLRILG
LGFEGRYSIIEEGDRQLTKIRQGLLTLLQSTRDTVPTALSPHGLIAHQFRKRRGIFVPVRVSMLLCGFLI
AATFIGSKYFLSVPESDLLKRMEALQRPVIVPTVAVQKLRLAILLKDEIAKQLVSVDETSSHSKVIFKGD
TMFQVGSDKVRPEIMSVIERVAQEVHRVQGAVLIIGHTDSMPINKPGFPNNQVLSEKRAANVARFMEKAG
IPTDKIQFEGKGDTQPVSSNDDAAGRSQNRRVEIFVNY
 
Nucleotide Sequence: 1377 bp     [Download]
>ref|NC_015224.1|:1876668-1878044 putative OmpA family protein [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
ATGAGTGATAGTAGTGAATTGAACCCTGGGATACCGATGCCCTCCTTTGATCAAAGCAGAGATGCGGATA
CCAATCCGCAGGCGTTAGGCCATTTCTTGCTTGATGAGCCGAGTGTTTACACCGAGAGCACACAATCTGG
TGCGGCGTTCAGCCACGAGGCTACGCGCTCACCGGGTTTTCAGCCCTATGATACCGCCCAGCTTCGAGGC
GAAAGTGTCCAGCAGCGCGTGGCTAAAGCGGTCGCGTCTCCAACGCCATTATTGGAGGCGGCACAGCCAT
TGTTACGTGCCTTAAGCGAGATGCCACAAGAGATAGCGGATGCTTCGCAGGTTCAGATATTAAAAGAGAG
CCTGAAGAATGAGATAACCCTGTTTAGTGTGGTATGTGATGAAGCGGATATCTCGTGGAAGAAAATGGCG
ATCGTCCGCTATTGCTTGTGTACCGCGCTAGATGAAGCGGCTCACACCATGTCGTGGGGCGTCATGTCGG
GTTGGTCGCAAAGCAACCTGCTAAACCATTTTGAAGGTGATAACGACGGCGGGAATAAATTTTTCCTGTT
AGTGGGCCGTCTGTCAATGAGCCCACATGAATATGCGGATTGCTTAGAGGTATTGCTGAGGATTTTAGGG
CTGGGTTTTGAAGGCCGTTACAGCATTATCGAAGAGGGTGACCGGCAATTAACCAAAATCCGTCAGGGAT
TGCTGACGTTACTGCAAAGTACCCGCGATACTGTTCCTACTGCGCTTTCTCCGCATGGATTAATCGCGCA
TCAGTTCCGCAAAAGGCGAGGGATTTTTGTTCCGGTTCGTGTGTCGATGCTGCTGTGTGGTTTCTTGATT
GCGGCCACCTTTATTGGCAGTAAATATTTTCTCTCCGTACCCGAAAGTGACTTGCTGAAGAGAATGGAAG
CCCTGCAACGTCCGGTTATCGTACCAACCGTTGCGGTACAAAAACTACGTCTGGCTATTTTGTTAAAAGA
CGAGATAGCGAAACAGCTAGTGAGTGTTGATGAAACAAGCAGTCACAGCAAAGTCATCTTCAAAGGCGAC
ACCATGTTCCAGGTGGGTTCGGATAAAGTCCGGCCCGAAATCATGAGTGTCATCGAGCGTGTTGCGCAGG
AAGTTCATCGCGTACAGGGGGCGGTGCTGATTATTGGGCATACCGACTCTATGCCGATCAACAAACCAGG
TTTCCCTAATAACCAGGTGCTTTCTGAGAAACGTGCTGCCAACGTTGCACGCTTTATGGAAAAAGCGGGT
ATCCCGACTGACAAAATTCAGTTTGAAGGGAAAGGGGATACGCAGCCAGTCAGTAGTAATGACGATGCAG
CCGGGCGTTCACAAAACCGCCGTGTAGAAATCTTTGTTAATTATTGA