SecReT6
Protein ID: 332161225
SecReT6 ID427
T6SS typei3
Gene symbol-
Locus tagYE105_C1603
StrainYersinia enterocolitica subsp. palearctica 105.5R(r)
Repliconchromosome [GenBank: NC_015224] [Browse all T6SS(s) in this replicon]
Location [Strand]1882068..1884383 [+]
Producthypothetical protein
NoteTssI
UniProt IDF0KS44
KEGG IDyep:YE105_C1603
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.00E-76, Aligned region: 18..337
Phage_base_V [PF04717], Evalue: 9.20E-25, Aligned region: 375..468
Gp5_C [PF06715], Evalue: 0.00015, Aligned region: 519..541
Gp5_C [PF06715], Evalue: 0.00015, Aligned region: 526..548
Gp5_C [PF06715], Evalue: 0.00015, Aligned region: 587..594
Protein Sequence: 771 a.a.     [Download]
>gi|332161225|ref|YP_004297802.1| hypothetical protein YE105_C1603 [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
MPYLLGEPALVLSKLEGEEAFSTLYSYTITAKTPANPSIPWQTASNVDLKALIGKEMTIEMELDGNGLDY
VKGVGKGTREISGLVEKARFIGRDANQAMFEIVLRPWFYLTDLTSDFKIFQNKNVVDIIDEVLADYNFPF
EKRLATTYPILDFQVQYGETDFNFLQRLMEEWGIYWFFEHDDHKQKLILVDHVGAHKRYFSEAYHTIEYL
SDEPKAGEEYITQFQTQETLTTGRWVYNDYDFTKSRADILTMDSKPRKTSFSDLEIYQWPGDYDQPDIGE
HLARVRIEERGALGSRAVGCGEVRGIVCGANFELQGFPVDKANREYMVISSRLSVSEVAQLSRGDEFHYE
TTFTVQPTTKIYRHPQLTPKPKTSGPQNAIVVGPPGEEVWTDEYGRVKVRFVWDRYGKNAESDSCWLRVS
QAWAGNSFGGIYIPRIGQEVLVDCINGDPDRPLVSGSLYNNVTRPPWDLPANATQSGMVSRTIGGGLTNY
NGVRFEDKPGLEQYWEQAERDMARLTKNDETQVIGANADLSVGANRSVLVGANSTSTVLGASAQSVALAS
SIQVGLARSVVVGATHALNVALANATNVGGANLTNVGGYNALSVGGAHQVAAGGAATLVAGGAVAIGAGG
ELVLSADTIKIVGKKKVIIQGGEIHLNSDDCCGGGGGGAGGGLAALSSLAGLKLLGGGIGLPLPLPPLPI
PPIIPPIPTIDPPVPTIDPPEPTDTPEPTDTXEPTDTPEPTDTPEPTDTPEPTEPPETPEPTPTDEQTPP
P
 
Nucleotide Sequence: 2316 bp     [Download]
>ref|NC_015224.1|:1882068-1884383 hypothetical protein YE105_C1603 [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
ATGCCCTATTTATTGGGTGAGCCTGCGCTGGTACTGTCGAAGTTAGAAGGAGAGGAAGCCTTTTCGACTT
TGTATTCATATACCATCACGGCAAAAACGCCGGCTAACCCCTCCATTCCTTGGCAGACAGCCTCTAATGT
CGATCTCAAAGCCTTAATTGGTAAAGAGATGACCATTGAAATGGAACTGGATGGTAATGGTCTCGATTAT
GTAAAAGGTGTCGGTAAAGGCACGCGTGAAATTTCTGGTTTGGTCGAAAAAGCCCGATTTATTGGCCGCG
ATGCCAATCAGGCAATGTTTGAAATTGTCCTTCGACCTTGGTTCTACCTCACAGATTTAACCTCTGACTT
TAAGATTTTTCAAAATAAAAATGTAGTAGATATTATTGATGAAGTGCTTGCTGACTATAACTTTCCGTTT
GAAAAGCGGCTGGCGACGACTTATCCAATACTCGACTTCCAGGTGCAATACGGTGAAACCGACTTTAATT
TCCTCCAGCGTTTAATGGAGGAGTGGGGTATTTACTGGTTCTTTGAACATGATGATCATAAACAAAAATT
AATTCTGGTCGACCATGTCGGTGCTCACAAACGTTATTTCAGTGAAGCTTACCATACCATTGAATATCTC
TCGGATGAGCCAAAGGCCGGGGAAGAATACATCACCCAATTCCAGACTCAGGAAACGCTAACTACTGGGC
GCTGGGTCTATAACGACTACGATTTCACCAAATCTCGTGCTGACATTTTGACGATGGACAGCAAGCCACG
CAAAACCAGTTTTAGCGATCTTGAAATTTATCAATGGCCTGGGGATTATGATCAGCCGGATATCGGGGAA
CATCTGGCGCGGGTGCGTATTGAGGAGCGCGGCGCATTGGGTTCGCGTGCCGTCGGTTGTGGCGAAGTTC
GTGGCATCGTTTGCGGTGCTAACTTCGAACTGCAAGGCTTCCCGGTTGATAAAGCTAACCGCGAATACAT
GGTTATCTCCAGCCGTTTGTCGGTTTCTGAAGTGGCACAGCTATCCCGTGGGGATGAGTTTCACTATGAA
ACTACGTTTACAGTTCAGCCAACCACCAAGATCTATCGGCATCCACAACTTACACCGAAGCCAAAAACCA
GCGGGCCACAGAATGCTATCGTTGTGGGCCCACCGGGCGAAGAGGTATGGACTGATGAATATGGCCGGGT
AAAAGTACGTTTTGTCTGGGACCGTTACGGCAAAAACGCAGAGTCGGACTCATGCTGGTTACGCGTGAGC
CAGGCTTGGGCTGGGAACAGTTTTGGTGGCATTTACATTCCGCGTATTGGTCAGGAAGTGTTGGTGGACT
GCATCAATGGCGACCCGGATCGCCCGTTGGTCAGCGGTAGTCTTTACAATAACGTGACTCGACCACCTTG
GGATTTACCTGCGAATGCCACACAAAGTGGTATGGTCAGCCGTACTATTGGCGGAGGGCTAACCAACTAT
AACGGCGTGCGTTTTGAGGACAAACCGGGCCTGGAGCAATACTGGGAGCAGGCCGAGCGCGATATGGCGC
GTCTGACGAAAAATGATGAAACACAAGTCATTGGCGCTAATGCTGATCTGAGTGTGGGGGCCAACCGCAG
CGTGCTTGTAGGGGCTAATTCGACATCAACTGTTCTTGGTGCTTCCGCGCAATCCGTCGCTTTAGCGTCT
TCAATACAAGTTGGATTGGCACGGAGTGTGGTCGTGGGAGCCACTCATGCGCTGAATGTCGCTTTAGCCA
ATGCCACCAACGTGGGGGGGGCCAACCTGACCAACGTCGGTGGTTACAACGCACTTTCTGTCGGTGGTGC
TCATCAGGTAGCTGCTGGCGGTGCTGCGACGCTGGTTGCTGGTGGTGCTGTGGCGATCGGTGCGGGTGGT
GAGCTGGTGCTCAGTGCTGATACCATCAAGATTGTCGGTAAAAAGAAAGTCATTATTCAAGGGGGAGAGA
TCCACCTTAACTCTGATGATTGTTGTGGCGGCGGAGGCGGCGGTGCGGGTGGTGGCTTAGCCGCGCTTTC
AAGCCTGGCGGGGCTGAAGCTACTGGGGGGAGGTATCGGGCTACCATTGCCATTACCACCATTGCCGATA
CCACCGATCATTCCACCGATACCGACAATTGATCCGCCGGTGCCAACAATTGATCCGCCAGAGCCGACCG
ATACGCCAGAGCCGACCGATACGNCAGAGCCGACCGATACGCCAGAACCGACCGATACGCCGGAGCCGAC
CGATACGCCGGAGCCGACTGAACCACCAGAGACACCAGAGCCAACGCCAACGGATGAACAGACGCCTCCG
CCTTGA