SecReT6
Protein ID: 332161228
SecReT6 ID427
T6SS typei3
Gene symbol-
Locus tagYE105_C1606
StrainYersinia enterocolitica subsp. palearctica 105.5R(r)
Repliconchromosome [GenBank: NC_015224] [Browse all T6SS(s) in this replicon]
Location [Strand]1885629..1886456 [+]
Producthypothetical protein
NoteTagJ
UniProt IDF0KS47
KEGG IDyep:YE105_C1606
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 8.00E-45, Aligned region: 144..263
TPR_11 [PF13414], Evalue: 0.0017, Aligned region: 43..76
TPR_11 [PF13414], Evalue: 0.0017, Aligned region: 106..137
TPR_14 [PF13428], Evalue: 0.0093, Aligned region: 35..65
TPR_14 [PF13428], Evalue: 0.0093, Aligned region: 104..137
Protein Sequence: 275 a.a.     [Download]
>gi|332161228|ref|YP_004297805.1| hypothetical protein YE105_C1606 [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
MNTTNLNELLKSSSLAEIQSDVIATLKAKPADTNARELLFKLYCLAGSWQKALLQIETLTKFAPDMTKQA
ELYKNLVLSETLREEVLAGKRDPGTLGNPLPEWAILMQQANQHLHEGDYSQSEELREQALSQAPESAGEN
SSATPFSWIADSDSRIGPVCEFISAGGYRWVPFADVQLMTISKPKNITDLVWAPAQLTVNNKVWYGYIPA
RYPLSLNADNDTKLGLKTEWSQPADSLYIGSGRKMFITDQNEYALFDIEEFRFDVEKFGFDEQAN
 
Nucleotide Sequence: 828 bp     [Download]
>ref|NC_015224.1|:1885629-1886456 hypothetical protein YE105_C1606 [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
ATGAATACGACCAACTTAAATGAATTATTGAAAAGCAGCTCATTGGCCGAAATACAATCGGATGTTATTG
CCACGTTGAAAGCCAAGCCGGCAGATACCAATGCACGCGAGCTATTATTTAAGCTCTATTGTTTGGCTGG
ATCATGGCAAAAAGCGTTATTGCAAATTGAAACACTGACTAAATTTGCCCCAGATATGACTAAGCAGGCA
GAGCTTTATAAGAATCTGGTCTTGAGTGAGACGTTGCGTGAAGAAGTGTTAGCAGGGAAACGCGATCCTG
GAACCTTAGGTAACCCCCTGCCTGAGTGGGCGATATTGATGCAGCAAGCTAACCAACATTTGCATGAGGG
TGATTACTCACAAAGCGAAGAACTGCGCGAGCAAGCATTGTCACAAGCCCCCGAAAGTGCTGGGGAAAAT
AGCTCAGCGACGCCCTTTTCATGGATAGCGGATAGTGATAGTCGCATCGGGCCGGTTTGTGAGTTTATCA
GCGCAGGCGGTTATCGGTGGGTACCTTTCGCTGATGTTCAATTAATGACGATTTCTAAGCCTAAAAATAT
TACAGACTTGGTATGGGCACCGGCACAATTGACGGTGAATAATAAAGTTTGGTACGGCTATATCCCGGCA
CGTTATCCGTTATCTCTCAATGCTGATAATGACACTAAACTTGGCCTTAAAACTGAATGGAGCCAACCGG
CAGACTCACTCTATATTGGTTCAGGGCGGAAAATGTTTATTACCGACCAAAATGAGTACGCATTATTCGA
TATTGAAGAGTTTAGATTTGATGTTGAAAAGTTTGGATTTGACGAACAGGCTAATTAA