SecReT6
Protein ID: 332161229
SecReT6 ID427
T6SS typei3
Gene symbol-
Locus tagYE105_C1607
StrainYersinia enterocolitica subsp. palearctica 105.5R(r)
Repliconchromosome [GenBank: NC_015224] [Browse all T6SS(s) in this replicon]
Location [Strand]1886456..1886935 [+]
Producthypothetical protein
NoteTssE
UniProt IDF0KS48
KEGG IDyep:YE105_C1607
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.30E-17, Aligned region: 35..138
Protein Sequence: 159 a.a.     [Download]
>gi|332161229|ref|YP_004297806.1| hypothetical protein YE105_C1607 [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
MEKKRQFLPTLLERLLDDEPKKLLEPHDKFFYDSRTMRKLVQRNIAEILNNANIDDRLDEQRHKWVAKSV
LNYGISPLVGRHSTPHNWTTIERIIREAIIRFEPRILADSLVVNQQHNARNGIIQFEIRGLIEWDPYPID
LCIGGAYDVETDQAELSAR
 
Nucleotide Sequence: 480 bp     [Download]
>ref|NC_015224.1|:1886456-1886935 hypothetical protein YE105_C1607 [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
ATGGAAAAGAAGAGACAGTTTTTGCCTACTCTGCTTGAGCGTTTACTTGATGATGAGCCTAAAAAATTGT
TAGAGCCTCATGATAAGTTTTTTTATGACTCACGTACGATGCGAAAACTGGTGCAGCGGAATATCGCTGA
AATATTAAATAATGCCAATATTGACGACCGGCTTGATGAACAGCGCCATAAGTGGGTGGCGAAGTCGGTT
TTAAATTACGGTATTTCGCCACTGGTGGGGAGGCATTCAACTCCCCATAACTGGACGACTATCGAGCGAA
TTATCCGTGAAGCAATCATCCGTTTTGAACCCCGGATCCTCGCAGATTCTCTGGTTGTCAATCAGCAGCA
TAATGCCAGAAATGGCATTATTCAGTTTGAAATCAGAGGTCTGATTGAGTGGGATCCGTATCCTATTGAT
TTGTGTATCGGCGGGGCCTATGACGTTGAAACCGATCAGGCAGAACTCAGCGCGCGTTAG