SecReT6
Protein ID: 332283595
SecReT6 ID436
T6SS typei3
Gene symbol-
Locus tagPT7_0342
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]399996..401048 [+]
Producthypothetical protein
NoteTssA
UniProt IDF4GWK9
KEGG IDput:PT7_0342
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.10E-19, Aligned region: 53..111
Protein Sequence: 350 a.a.     [Download]
>gi|332283595|ref|YP_004415506.1| hypothetical protein PT7_0342 [Pusillimonas sp. T7-7]
MAALADLFTTFETPSSCGENLEYSPEFLALQQAVAGKPEQQFGSTIIPEQAPDWALIEREAAELSGRTCD
IRIIVLLAQAWTELRGLPGFADGIQLLATVLDRHWDHVYPLLILDDEHDPMPRMNALVALGDTQGTARSV
RSAPLLQGAHGQVSVREAEALLDGSKTQSETYPGGRPRLVEALRHARLLEAPELLAVSQALVGLKAIEDT
VGSRIGSEWVPDFMSVRRTLGVIADLTDAAAEEARQEASASSDADEAPGPADSLPVEQSSSARPVSAGVW
REAVIQTRDDALLALEKASLYFERYEPSHPAPFLIRRAQQTIPLDFYEMLKNLAPQGLDQFEAWVPKSGA
 
Nucleotide Sequence: 1053 bp     [Download]
>gi|332283253|ref|NC_015458.1|:399996-401048 Pusillimonas sp. T7-7 chromosome, complete genome
ATGGCTGCGCTTGCTGACCTATTCACTACCTTTGAGACGCCGTCTTCCTGCGGTGAAAACCTGGAGTACA
GCCCGGAGTTCCTGGCTTTGCAGCAGGCGGTGGCCGGCAAACCCGAGCAACAGTTTGGTTCAACCATTAT
TCCTGAGCAGGCGCCCGATTGGGCCTTGATTGAACGCGAAGCCGCCGAACTGAGCGGGCGCACCTGCGAT
ATCAGGATTATTGTGTTGCTGGCACAGGCCTGGACGGAGTTGAGGGGCTTGCCGGGTTTTGCCGACGGTA
TTCAGCTATTGGCCACTGTGCTGGATCGCCATTGGGATCATGTATATCCATTGTTGATTCTTGACGACGA
GCATGACCCCATGCCGCGCATGAATGCGCTGGTCGCATTGGGAGATACGCAAGGAACCGCTCGCAGCGTA
CGCTCGGCGCCGCTGCTGCAGGGGGCTCATGGGCAGGTTTCGGTGCGAGAGGCCGAAGCTCTGCTGGACG
GCAGCAAGACGCAGTCCGAAACCTATCCGGGTGGACGCCCCCGCCTGGTCGAGGCTTTACGCCATGCCCG
CTTGCTGGAGGCGCCAGAGTTGTTGGCGGTTTCGCAGGCGCTGGTCGGACTGAAGGCTATTGAAGATACG
GTGGGGTCCCGGATCGGATCCGAGTGGGTGCCGGACTTCATGAGTGTGCGGCGTACCTTGGGTGTGATTG
CTGATCTAACCGACGCGGCTGCCGAAGAAGCCCGGCAAGAGGCGTCGGCTTCTTCAGACGCTGATGAAGC
CCCAGGACCAGCCGACAGCTTGCCAGTAGAGCAGTCGTCCAGTGCACGTCCGGTATCTGCTGGCGTCTGG
CGTGAGGCTGTCATTCAAACCCGTGACGATGCGCTGCTGGCGCTTGAAAAAGCCTCTCTTTACTTTGAGC
GCTACGAGCCCAGCCACCCCGCGCCTTTCCTGATACGCCGGGCGCAACAAACCATACCTCTGGATTTTTA
CGAAATGCTGAAGAACCTTGCTCCCCAGGGCCTGGATCAGTTTGAGGCCTGGGTGCCAAAAAGCGGAGCG
TAA