SecReT6
Protein ID: 332283596
SecReT6 ID436
T6SS typei3
Gene symbol-
Locus tagPT7_0343
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]401109..401660 [+]
Producthypothetical protein
NoteTssB
UniProt IDF4GWL0
KEGG IDput:PT7_0343
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.40E-58, Aligned region: 11..164
Protein Sequence: 183 a.a.     [Download]
>gi|332283596|ref|YP_004415507.1| hypothetical protein PT7_0343 [Pusillimonas sp. T7-7]
MATSKSGQKFVARNRAPRVQIEYDVEIYGAERTINLPFVMGVMADLAGKSTQPQPEVAERKFMDVDIDNF
DDRMKAIKPRVAFHVPNTLTGDGQLAVDIEFNSINDFSPATVANKVEALKGLLDARTELANLLTYMDGKT
GAEELIGKVLENPALMGALAAAPKAPSETIEDSSDDDRTTKQA
 
Nucleotide Sequence: 552 bp     [Download]
>gi|332283253|ref|NC_015458.1|:401109-401660 Pusillimonas sp. T7-7 chromosome, complete genome
ATGGCGACCAGTAAAAGTGGACAGAAATTTGTAGCGCGTAACAGGGCGCCACGCGTACAGATCGAGTATG
ACGTTGAGATTTATGGCGCGGAACGCACCATAAATTTGCCTTTTGTCATGGGGGTTATGGCGGATCTGGC
GGGCAAGTCGACGCAGCCTCAACCCGAGGTGGCCGAGCGCAAGTTCATGGATGTCGATATCGATAATTTC
GATGATCGCATGAAGGCCATCAAGCCAAGGGTGGCATTTCATGTGCCCAATACGCTTACGGGCGATGGCC
AGTTGGCGGTCGATATTGAATTCAACAGCATCAACGATTTCTCTCCTGCAACGGTAGCGAATAAGGTTGA
GGCCTTGAAAGGCCTGCTGGATGCCCGCACGGAACTGGCCAACTTGCTGACTTACATGGACGGCAAGACC
GGTGCGGAAGAGTTGATAGGCAAGGTGCTGGAAAACCCGGCCCTGATGGGCGCCCTTGCTGCTGCCCCCA
AAGCCCCGTCAGAGACGATCGAAGATAGCAGTGACGACGATCGCACCACTAAACAGGCTTGA