SecReT6
Protein ID: 332283597
SecReT6 ID436
T6SS typei3
Gene symbol-
Locus tagPT7_0344
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]401676..403187 [+]
Producthypothetical protein
NoteTssC
UniProt IDF4GWL1
KEGG IDput:PT7_0344
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.80E-194, Aligned region: 70..496
Protein Sequence: 503 a.a.     [Download]
>gi|332283597|ref|YP_004415508.1| hypothetical protein PT7_0344 [Pusillimonas sp. T7-7]
MNAQTQNTALQELPEDLYLEQADGLSALLQKEFKPKTDQAREAVEHAVKTLAQQALEHSVTMSSDAYQSI
QAIIAEIDNKLSEQINLILHHEQFQQLEGAWRGLHYLVNNSETDEMLKIRAMCITKKELGRTLKRHKGVG
WDQSPIFKRVYEEEYGQFGGEPLGCLVGDYYFDHSPQDIELLGEIAKVSAAAHCPFISGASPDVMQMDSW
QELANPRDLTNIFTNTEYAAWRSLRESEDSRYVGLAMPRFLSRLPYGARTNPVDEFDFEEETDGASHDRY
TWSNSAYAMAANINRSFKEYGWCTSIRGVESGGAVENMLCHTFPTDDGGVDMKCPTEIAISDRREAELAK
SGFMPLVHRKNSDFAAFIGAQSLQKPAEYYDADASANARLSARLPYLFACCRFAHYLKCIVRDKIGSFRE
RDDMERWLNDWIMNYVDGDPVNSSQETKARKPLAAAEVQVQELEDNPGYYSAKFFLRPHYQLEGLTVSLR
LVSKLPSLKQNDS
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|332283253|ref|NC_015458.1|:401676-403187 Pusillimonas sp. T7-7 chromosome, complete genome
ATGAACGCACAAACCCAGAACACCGCGCTGCAGGAATTGCCGGAAGATCTATACCTTGAACAGGCCGATG
GTTTGTCGGCCTTGCTGCAAAAGGAATTCAAGCCGAAGACGGATCAGGCAAGAGAAGCCGTAGAACATGC
CGTCAAAACATTGGCCCAGCAAGCGCTGGAGCATTCGGTAACCATGTCTTCCGACGCTTATCAGTCCATC
CAGGCGATCATTGCCGAGATAGACAACAAGCTTTCTGAACAGATCAACCTGATTCTGCATCACGAGCAGT
TCCAACAGCTGGAAGGCGCCTGGCGTGGCCTGCACTATCTGGTCAATAACAGCGAAACCGATGAAATGCT
GAAGATCAGGGCCATGTGCATTACCAAGAAGGAGCTGGGACGCACCCTCAAGCGCCATAAAGGCGTGGGC
TGGGATCAAAGCCCCATTTTCAAACGCGTATACGAAGAAGAGTATGGCCAGTTTGGCGGCGAGCCACTGG
GCTGCCTGGTGGGTGACTACTACTTTGACCATAGCCCGCAAGATATCGAGCTGCTGGGTGAAATTGCCAA
GGTCTCGGCCGCTGCGCACTGCCCCTTTATTTCAGGCGCGTCGCCTGATGTCATGCAAATGGATTCCTGG
CAGGAACTGGCCAACCCACGAGATCTGACCAATATATTCACCAATACCGAGTATGCAGCCTGGCGCAGCC
TGCGCGAATCAGAAGATTCACGCTATGTGGGCTTGGCGATGCCGCGATTTCTGTCGCGGCTGCCTTATGG
TGCCCGTACCAACCCGGTGGATGAGTTTGATTTTGAAGAGGAAACCGACGGCGCCAGCCACGATCGCTAT
ACCTGGTCGAATTCCGCGTATGCGATGGCGGCCAACATCAACAGATCGTTCAAAGAATATGGCTGGTGCA
CCTCGATACGTGGAGTGGAGTCTGGCGGTGCGGTAGAGAATATGCTGTGCCACACCTTCCCGACGGATGA
CGGTGGCGTCGACATGAAGTGCCCCACCGAGATAGCCATTAGCGACAGGCGCGAGGCCGAGCTGGCCAAG
AGCGGCTTCATGCCGCTCGTGCATCGCAAGAACTCCGACTTCGCCGCCTTTATTGGAGCACAGTCACTGC
AGAAGCCGGCCGAATACTACGATGCCGACGCCTCGGCCAATGCCCGCTTGTCAGCGCGGCTGCCGTATCT
GTTTGCCTGCTGCCGCTTTGCGCATTACCTGAAGTGCATTGTTCGCGACAAGATTGGTTCGTTCCGCGAG
CGCGACGACATGGAGCGCTGGCTGAATGACTGGATCATGAATTATGTGGATGGAGATCCGGTCAATTCGT
CACAGGAAACCAAGGCGCGCAAGCCATTGGCGGCCGCTGAGGTGCAAGTGCAAGAGCTGGAGGACAACCC
AGGCTATTACTCTGCCAAGTTTTTTCTTCGACCTCATTATCAGCTTGAAGGGCTGACGGTCTCTTTACGG
CTGGTGTCCAAACTGCCTTCGTTGAAACAGAACGACAGCTGA