SecReT6
Protein ID: 332283598
SecReT6 ID436
T6SS typei3
Gene symbol-
Locus tagPT7_0345
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]403293..403763 [+]
Producthypothetical protein
NoteTssD
UniProt IDF4GWL2
KEGG IDput:PT7_0345
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.90E-37, Aligned region: 2..132
Protein Sequence: 156 a.a.     [Download]
>gi|332283598|ref|YP_004415509.1| hypothetical protein PT7_0345 [Pusillimonas sp. T7-7]
MFMKIDGANGESKDANHKDWTDIQSFSWGATQPGAITSGGGGGIGKANFNDLHVVARIDKAAPAVMKHCA
NGKHLSKIELSLCKAGGSQIEYSKITLDDVLVTSVQIAADDKSEAVLVNYAFQAAKVKQQYWEQTESGGK
GAESLVAWDIKQNKEA
 
Nucleotide Sequence: 471 bp     [Download]
>gi|332283253|ref|NC_015458.1|:403293-403763 Pusillimonas sp. T7-7 chromosome, complete genome
ATGTTCATGAAAATCGATGGCGCCAATGGCGAATCGAAGGATGCGAACCATAAGGATTGGACCGACATTC
AATCGTTTTCCTGGGGCGCCACGCAGCCTGGCGCCATTACCTCCGGCGGTGGTGGCGGCATCGGCAAGGC
CAACTTCAATGATCTGCATGTGGTTGCCCGCATCGACAAGGCGGCGCCCGCTGTCATGAAGCATTGCGCC
AACGGCAAGCATCTGAGCAAGATCGAGTTGTCGCTGTGCAAGGCTGGCGGCAGCCAGATCGAATACTCCA
AGATCACGCTGGACGATGTACTGGTGACTTCGGTACAGATTGCGGCAGACGACAAATCGGAAGCGGTATT
GGTCAACTATGCCTTCCAGGCTGCCAAAGTCAAGCAGCAGTACTGGGAGCAGACGGAATCGGGTGGCAAG
GGCGCAGAAAGCCTGGTTGCCTGGGACATCAAGCAGAACAAAGAAGCTTAA