SecReT6
Protein ID: 332283599
SecReT6 ID436
T6SS typei3
Gene symbol-
Locus tagPT7_0346
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]403856..404395 [+]
Producthypothetical protein
NoteTssE
UniProt IDF4GWL3
KEGG IDput:PT7_0346
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.00E-20, Aligned region: 46..157
Protein Sequence: 179 a.a.     [Download]
>gi|332283599|ref|YP_004415510.1| hypothetical protein PT7_0346 [Pusillimonas sp. T7-7]
MQGNNKIRGPGDDPRIARDRLQPALLDRLTDDAPRQRAESQQGMLTHAQLRLAVLRDLNWLLNTVSIESS
HDLTQCSHVRTSSLNFGVRALAGKRMSEVDWVDLERAITEAIIHFEPRILADTISVQCITDTDVLEHHNI
LSFKIKGLLWCVPYHQEFLFRTVIDLESGHIDLSDMGAH
 
Nucleotide Sequence: 540 bp     [Download]
>gi|332283253|ref|NC_015458.1|:403856-404395 Pusillimonas sp. T7-7 chromosome, complete genome
GTGCAAGGCAACAACAAAATTCGTGGTCCTGGTGATGATCCACGTATTGCACGTGACCGCCTGCAGCCTG
CCTTGCTGGATCGTTTGACAGACGATGCGCCCAGGCAGCGCGCCGAATCTCAGCAGGGCATGCTGACGCA
TGCTCAATTACGCCTTGCCGTGCTGCGCGATTTGAACTGGCTGCTCAATACCGTAAGCATTGAGTCGTCG
CACGATTTGACCCAATGCTCCCATGTCAGGACATCGTCCCTTAATTTTGGCGTACGCGCCCTGGCGGGCA
AGCGGATGTCGGAAGTGGACTGGGTGGACCTTGAGCGCGCCATCACTGAAGCGATCATTCATTTTGAGCC
ACGCATACTGGCCGATACGATTTCCGTCCAGTGCATTACCGACACTGATGTACTGGAGCACCATAATATT
CTGAGTTTCAAGATCAAAGGCCTGCTTTGGTGCGTGCCTTATCACCAGGAGTTCCTGTTCCGCACCGTCA
TAGACCTGGAAAGCGGCCATATCGATCTAAGTGACATGGGCGCCCACTGA