SecReT6
Protein ID: 332283600
SecReT6 ID436
T6SS typei3
Gene symbol-
Locus tagPT7_0347
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]404395..406284 [+]
Producthypothetical protein
NoteTssF
UniProt IDF4GWL4
KEGG IDput:PT7_0347
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.20E-212, Aligned region: 5..628
Protein Sequence: 629 a.a.     [Download]
>gi|332283600|ref|YP_004415511.1| hypothetical protein PT7_0347 [Pusillimonas sp. T7-7]
MQPRLLEYYNRELEYLRELGAEFAERYPKVAGRLAMNGTEVADPYVERLLEGFSFLTARIQMKMDAEFPR
FSQRLMDVAYPNYLAPVPSMTVVQFAPSMNEGTLATGFRLPRGTVLRAGLTQGEQTRCEFSTAHELTLWP
IRVESAELTGPPVDLPLSRLGLSGRGSPVRAALRIRIALCGGSLLHELDLDQLMFYLNGQDVQMSRLLEL
AVGHTVAVLCHDTSRPVSSIERLPKSVVRHEGFDTEQALLPADARLFQGYRLLQEYFAFPDRYRFFSING
LGPALERIGASQTCKAFELTVLLDSSVPELENLITAEHLALHCTPAINLVSRRADRIAVSTREHEHHVVV
ERSSPRDYEVFSVNKVIGHISSDEQQEFRPFYSSVEKDGGDYGAYFSLRREARVLSDMGKREGTRTAYTG
SEVFLSLVDRNEAPHSEKLRHLSVETLCTNRDLPLLLPRGGETDFTLRISAPVSSVRILKGPTRPRPALT
DSATTWRLISHMGLNYLSLVDVDEQQGAHAMRELLSLYTNMADAATSRQISGLRSVRIKAMHRHLPVPGP
LLMGRGVKIDVSVDETAFAGISPFMFGAVLEQFFARHVSINMMTEMSLSTLQRGQLARWSVRLGGRPAV
 
Nucleotide Sequence: 1890 bp     [Download]
>gi|332283253|ref|NC_015458.1|:404395-406284 Pusillimonas sp. T7-7 chromosome, complete genome
ATGCAGCCGCGTCTGCTTGAATACTACAACCGGGAACTCGAGTATCTGCGGGAGTTGGGCGCCGAGTTTG
CCGAGCGCTATCCCAAGGTAGCCGGGCGGCTGGCCATGAACGGCACTGAGGTGGCAGACCCTTATGTGGA
GCGTCTGCTGGAAGGCTTCAGCTTCTTGACGGCGCGCATCCAGATGAAGATGGATGCGGAGTTTCCCCGC
TTTTCACAGCGCTTGATGGATGTGGCGTATCCTAACTATCTGGCGCCTGTGCCTTCCATGACAGTGGTGC
AGTTCGCACCCAGCATGAATGAAGGGACGCTGGCGACCGGCTTCCGCTTACCGCGTGGCACTGTACTGCG
CGCAGGCCTGACTCAGGGAGAGCAGACCCGTTGTGAGTTTTCCACTGCGCACGAGCTGACCTTATGGCCC
ATACGTGTTGAAAGTGCGGAGCTGACGGGGCCACCGGTAGATCTTCCTTTGAGCCGCCTGGGTCTGTCAG
GTCGCGGCTCGCCTGTGCGGGCTGCGCTGCGCATACGCATTGCATTATGTGGAGGCTCCTTGCTGCATGA
GCTGGACCTGGATCAGCTGATGTTCTACCTGAACGGGCAGGACGTGCAAATGAGCCGTTTGCTGGAGCTG
GCAGTCGGCCATACGGTTGCCGTGCTATGCCATGATACGAGCCGGCCGGTAAGTAGTATTGAACGCCTGC
CCAAATCAGTGGTCCGCCATGAAGGCTTCGATACGGAGCAGGCTCTTTTACCTGCCGATGCGCGGCTGTT
CCAGGGCTATCGCCTGTTGCAGGAATACTTTGCTTTCCCCGATCGCTATCGTTTTTTCAGCATCAACGGC
CTCGGGCCGGCATTGGAGCGAATAGGCGCCAGCCAGACCTGCAAGGCGTTTGAACTGACCGTCTTGCTGG
ACAGCAGCGTGCCTGAACTGGAGAATCTGATTACGGCTGAGCATTTGGCCCTGCACTGTACTCCCGCCAT
CAACCTGGTTTCCAGGAGAGCAGACCGGATTGCAGTCAGTACACGCGAACATGAACATCATGTGGTGGTT
GAGCGTTCCAGCCCTCGGGATTATGAAGTGTTCAGCGTGAACAAAGTCATAGGCCATATCTCGTCGGATG
AGCAGCAGGAATTTCGTCCCTTTTACAGTTCGGTCGAGAAGGACGGCGGCGACTACGGCGCCTACTTCTC
GCTCCGTCGCGAAGCCCGTGTGTTGTCCGATATGGGCAAACGCGAGGGCACGCGCACGGCCTACACCGGC
AGCGAAGTCTTTCTTTCCCTGGTAGACCGCAATGAAGCGCCTCACTCCGAAAAGCTGCGTCATTTAAGCG
TGGAAACCTTATGTACCAATCGTGATTTGCCGTTGTTGCTGCCCCGCGGCGGCGAGACCGATTTCACGCT
GAGGATTTCGGCGCCTGTATCGTCGGTGCGTATTCTTAAAGGGCCAACCCGGCCCCGGCCGGCACTGACC
GACAGCGCAACAACCTGGCGCTTGATCAGTCATATGGGCCTCAATTATTTGAGCCTGGTCGACGTCGATG
AGCAGCAGGGCGCGCATGCCATGCGCGAGTTGCTCAGCCTTTACACCAATATGGCCGATGCCGCGACCAG
CCGGCAAATTTCCGGCTTGCGGAGTGTCCGCATCAAGGCGATGCATCGCCATTTACCCGTGCCGGGCCCC
TTGCTGATGGGGCGAGGCGTGAAAATTGACGTCAGTGTCGATGAAACAGCCTTTGCCGGCATCAGTCCCT
TTATGTTTGGGGCTGTACTGGAACAGTTTTTTGCGCGTCATGTGTCCATAAATATGATGACGGAAATGAG
CTTGTCCACGCTGCAGCGTGGACAGCTTGCCCGTTGGTCGGTTCGCCTGGGCGGCCGCCCAGCAGTCTGA