SecReT6
Protein ID: 332283601
SecReT6 ID436
T6SS typei3
Gene symbol-
Locus tagPT7_0348
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]406294..407373 [+]
Producthypothetical protein
NoteTssG
UniProt IDF4GWL5
KEGG IDput:PT7_0348
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.70E-109, Aligned region: 36..336
Protein Sequence: 359 a.a.     [Download]
>gi|332283601|ref|YP_004415512.1| hypothetical protein PT7_0348 [Pusillimonas sp. T7-7]
MRSAYNEIEHTSGIKPDAVVAGPADLPEGFWGRLTENPYAHDLFRVLRWIDARAGARKPLGRASTPRDEP
VRMRQTPSMAFAPSTLSAASCDDPDGIRELSIYSFGLFGPNGPLPLHLTEYARGRIHHHGDDTLTAFADV
FHHRLILLFYRAWADAQSTVSLDHAGQQFSRYLASLLHMGTDGQQGRDSIPDHAKYYMAGHLLRQTRNPE
GLQLILHTYFAVPVQIREFIPQWIHLEQDQQLMLGDAEAALGRSTLLGMAVRDAQHKFRIELGPLRIESY
MQLLPGARQARQLLDWVRQYVGLEYEWDVLLVLDQRDVHGLALGQSTPLGLSSWLGLRDPLRGDARDVVL
NLEQRIRAA
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|332283253|ref|NC_015458.1|:406294-407373 Pusillimonas sp. T7-7 chromosome, complete genome
ATGCGCAGCGCTTACAATGAAATAGAGCACACCTCGGGTATCAAGCCCGATGCAGTTGTGGCCGGGCCAG
CCGATTTACCCGAAGGGTTCTGGGGCCGCTTGACTGAAAACCCGTATGCACATGATCTGTTTCGTGTGCT
GCGATGGATAGACGCCCGGGCTGGCGCCCGTAAACCACTGGGCCGGGCGAGTACGCCCCGTGATGAGCCC
GTGCGGATGCGACAGACACCCAGCATGGCGTTCGCCCCGTCTACGCTGTCGGCGGCATCTTGCGATGACC
CGGATGGTATACGCGAGCTGTCGATCTACAGTTTTGGGCTGTTTGGACCGAACGGACCTTTGCCCCTGCA
CCTGACGGAGTATGCGCGGGGGCGGATACATCATCATGGCGACGACACGCTGACGGCCTTTGCGGATGTT
TTTCATCACAGGCTGATTCTGCTGTTTTACCGTGCCTGGGCAGATGCCCAGAGTACTGTGAGTCTGGACC
ATGCGGGCCAGCAATTCAGCCGCTACCTGGCCAGTTTGCTGCATATGGGTACGGACGGGCAGCAGGGCCG
GGACAGCATTCCGGATCATGCAAAGTACTACATGGCGGGTCATCTGCTGCGGCAGACGCGCAACCCGGAA
GGGCTGCAGCTAATCTTGCATACCTATTTTGCCGTACCGGTGCAGATTCGCGAATTCATTCCCCAATGGA
TACATCTGGAGCAGGACCAGCAACTGATGCTGGGCGATGCCGAGGCGGCGTTGGGGCGCAGCACGCTGCT
GGGCATGGCAGTGCGCGATGCTCAGCATAAGTTCCGTATTGAACTGGGACCCTTGCGTATTGAATCTTAT
ATGCAGCTCTTACCAGGCGCCAGGCAAGCCCGGCAGCTACTGGACTGGGTGCGCCAGTATGTTGGCCTGG
AGTACGAGTGGGATGTGCTGTTGGTGCTCGATCAGCGTGATGTGCATGGACTGGCATTGGGACAGTCAAC
ACCACTGGGCCTGTCCAGCTGGCTGGGCTTGCGCGATCCGCTACGAGGCGATGCGCGTGATGTCGTGTTG
AATCTTGAGCAACGCATAAGGGCTGCTTGA