SecReT6
Protein ID: 332283602
SecReT6 ID436
T6SS typei3
Gene symbol-
Locus tagPT7_0349
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]407370..410054 [+]
ProductATPase with chaperone activity
NoteTssH
UniProt IDF4GWL6
KEGG IDput:PT7_0349
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 6.40E-40, Aligned region: 244..351
AAA_2 [PF07724], Evalue: 6.40E-40, Aligned region: 626..792
AAA [PF00004], Evalue: 6.00E-20, Aligned region: 245..375
AAA [PF00004], Evalue: 6.00E-20, Aligned region: 632..716
ClpB_D2-small [PF10431], Evalue: 9.80E-15, Aligned region: 226..239
ClpB_D2-small [PF10431], Evalue: 9.80E-15, Aligned region: 538..549
ClpB_D2-small [PF10431], Evalue: 9.80E-15, Aligned region: 800..872
AAA_5 [PF07728], Evalue: 2.00E-11, Aligned region: 245..323
AAA_5 [PF07728], Evalue: 2.00E-11, Aligned region: 631..749
AAA_16 [PF13191], Evalue: 2.20E-09, Aligned region: 222..264
AAA_16 [PF13191], Evalue: 2.20E-09, Aligned region: 289..324
AAA_16 [PF13191], Evalue: 2.20E-09, Aligned region: 496..520
AAA_16 [PF13191], Evalue: 2.20E-09, Aligned region: 501..573
AAA_16 [PF13191], Evalue: 2.20E-09, Aligned region: 622..675
AAA_22 [PF13401], Evalue: 2.90E-09, Aligned region: 245..326
AAA_22 [PF13401], Evalue: 2.90E-09, Aligned region: 387..411
AAA_22 [PF13401], Evalue: 2.90E-09, Aligned region: 498..550
AAA_22 [PF13401], Evalue: 2.90E-09, Aligned region: 630..658
AAA_22 [PF13401], Evalue: 2.90E-09, Aligned region: 692..714
Sigma54_activat [PF00158], Evalue: 1.80E-07, Aligned region: 229..261
Sigma54_activat [PF00158], Evalue: 1.80E-07, Aligned region: 631..744
AAA_19 [PF13245], Evalue: 2.40E-06, Aligned region: 243..268
AAA_19 [PF13245], Evalue: 2.40E-06, Aligned region: 387..418
AAA_19 [PF13245], Evalue: 2.40E-06, Aligned region: 629..654
AAA_14 [PF13173], Evalue: 4.80E-06, Aligned region: 157..191
AAA_14 [PF13173], Evalue: 4.80E-06, Aligned region: 245..325
AAA_14 [PF13173], Evalue: 4.80E-06, Aligned region: 362..411
AAA_14 [PF13173], Evalue: 4.80E-06, Aligned region: 630..727
AAA_17 [PF13207], Evalue: 7.60E-06, Aligned region: 245..288
AAA_17 [PF13207], Evalue: 7.60E-06, Aligned region: 466..541
AAA_17 [PF13207], Evalue: 7.60E-06, Aligned region: 630..666
IstB_IS21 [PF01695], Evalue: 8.60E-06, Aligned region: 227..265
IstB_IS21 [PF01695], Evalue: 8.60E-06, Aligned region: 631..652
IstB_IS21 [PF01695], Evalue: 8.60E-06, Aligned region: 741..762
Zeta_toxin [PF06414], Evalue: 1.10E-05, Aligned region: 245..268
Zeta_toxin [PF06414], Evalue: 1.10E-05, Aligned region: 326..411
Zeta_toxin [PF06414], Evalue: 1.10E-05, Aligned region: 621..671
NACHT [PF05729], Evalue: 4.00E-05, Aligned region: 245..280
NACHT [PF05729], Evalue: 4.00E-05, Aligned region: 631..669
AAA_25 [PF13481], Evalue: 4.70E-05, Aligned region: 239..269
AAA_25 [PF13481], Evalue: 4.70E-05, Aligned region: 297..335
AAA_25 [PF13481], Evalue: 4.70E-05, Aligned region: 496..551
AAA_25 [PF13481], Evalue: 4.70E-05, Aligned region: 628..653
Arch_ATPase [PF01637], Evalue: 7.10E-05, Aligned region: 224..265
Arch_ATPase [PF01637], Evalue: 7.10E-05, Aligned region: 630..666
AAA_29 [PF13555], Evalue: 0.00013, Aligned region: 237..261
AAA_29 [PF13555], Evalue: 0.00013, Aligned region: 629..656
AAA_18 [PF13238], Evalue: 0.00023, Aligned region: 245..270
AAA_18 [PF13238], Evalue: 0.00023, Aligned region: 487..548
AAA_18 [PF13238], Evalue: 0.00023, Aligned region: 632..660
SRP54 [PF00448], Evalue: 0.0061, Aligned region: 244..266
SRP54 [PF00448], Evalue: 0.0061, Aligned region: 630..662
RNA_helicase [PF00910], Evalue: 0.0078, Aligned region: 246..266
RNA_helicase [PF00910], Evalue: 0.0078, Aligned region: 632..653
Hpr_kinase_C [PF07475], Evalue: 0.0082, Aligned region: 245..257
Hpr_kinase_C [PF07475], Evalue: 0.0082, Aligned region: 628..649
DUF258 [PF03193], Evalue: 0.0084, Aligned region: 237..262
DUF258 [PF03193], Evalue: 0.0084, Aligned region: 630..650
Protein Sequence: 894 a.a.     [Download]
>gi|332283602|ref|YP_004415513.1| ATPase with chaperone activity [Pusillimonas sp. T7-7]
MKQSWLHCCASLNIFINKVEAMSDISRVELFGKLGDVMYRTLDGAATFCKLRHHSHVELVHWLHQLTHSQ
NTDLHAIMAYFELDAAVVDTGILKALDQLPQGAGSVSDLSGHIDEAVERAWIYASLKYSMMRIRSGHLMA
GLLKTSSLRHVLFGISPEFKKIVPDLLLMKFDEIVQGSSEQDASAQAAPQLDSGKASQGAVALAQYAVDL
TARARTGQIDPVSGRNEEIRQIIDILMRRRQNNPLLTGEAGVGKTAVIEGLALRLAHGDVPPALREVSLY
MLDLGLLQAGASMKGEFEARLRSIIDAIQFSEKPIVLFIDEIHTLVGAGGAAGTGDAANLLKPVLARGQL
RTIGATTWSEYKKYIEKDPALTRRFQPVQIAEPSEEQAVVMLRGLARILGEHHKVLLLDEAIDAAVRLSY
RYIPARQLPDKAVALLDTACARVAVSQHAVPADLEDCRREIEALEIELDMLEREQKLGIEHLVRNEQVQA
RLASSQERLAVLDGRWQTEHVLVTQLHGLQTALHEAGSELDEQVRLRAELDELRQQLARHQGEAPLIFPS
VDAAAVAAVVAEWTGIPVGRMLRDEAASVLQLAETLEKRVVGQRHGLDAIARRIETSRAKLTDPNKPVGV
FLLCGPSGVGKTETALALADTLYGGEQNVIAINMSEFQESHTVSTLKGAPPGYVGYGEGGGLTEAVRRRP
YSVILLDEVEKAHPDVHEIFFQVFDKGWMEDGEGRYIDFRHTVIILTSNVGSDRMAAMCRDPEQLPSPDQ
LQQALRQPLLQMFPAALLGRLIVVPYYSLPDSMLAQIVVLQLERIRARLMDNHQVQMTVQPEVIDLIVER
CTEVESGGRMIDSILSNTVLPRVSRELLTAAVGAQSISAVTLAAEDGEFVYRFS
 
Nucleotide Sequence: 2685 bp     [Download]
>gi|332283253|ref|NC_015458.1|:407370-410054 Pusillimonas sp. T7-7 chromosome, complete genome
TTGAAGCAAAGCTGGCTGCACTGTTGTGCAAGCCTGAATATTTTCATTAATAAAGTTGAAGCCATGTCAG
ACATAAGCCGTGTAGAACTTTTTGGTAAGCTGGGTGATGTCATGTACCGGACGCTTGACGGCGCCGCGAC
ATTCTGCAAATTGCGTCATCACTCCCACGTCGAGCTGGTGCATTGGCTGCATCAGCTGACCCACTCCCAG
AACACTGATCTGCATGCCATCATGGCGTATTTCGAGCTGGATGCGGCGGTGGTTGATACCGGCATTCTGA
AGGCACTGGATCAATTGCCGCAGGGTGCGGGTTCTGTATCCGACCTGTCAGGGCATATTGATGAGGCTGT
TGAAAGAGCATGGATATATGCCTCGCTAAAGTACAGCATGATGCGGATACGCAGCGGACACCTGATGGCC
GGCTTGCTAAAGACCTCCAGCCTGCGTCATGTGCTGTTTGGCATATCGCCCGAGTTCAAGAAGATTGTGC
CTGACTTGTTGTTGATGAAGTTTGATGAGATCGTGCAAGGTTCCTCTGAGCAGGATGCAAGCGCACAGGC
TGCTCCGCAGCTTGACTCCGGCAAGGCCTCGCAGGGCGCCGTGGCCTTGGCTCAGTATGCAGTGGATTTG
ACCGCGCGTGCCCGGACGGGCCAGATCGACCCGGTATCGGGGCGCAATGAGGAAATCCGGCAGATCATCG
ACATTTTGATGCGGCGTCGCCAGAATAATCCCTTGCTTACTGGCGAGGCCGGCGTGGGCAAGACCGCCGT
GATCGAGGGGCTTGCCCTGCGCCTTGCCCACGGCGATGTGCCGCCCGCTTTGCGTGAAGTATCTTTGTAC
ATGCTGGATTTGGGGCTGTTGCAGGCCGGCGCGAGTATGAAGGGCGAGTTCGAGGCGCGACTCCGTTCCA
TCATTGACGCCATACAATTCAGCGAAAAACCCATAGTGCTGTTCATTGATGAAATCCACACGTTGGTGGG
CGCGGGCGGTGCTGCCGGCACGGGGGACGCGGCCAATTTGCTCAAGCCGGTTCTGGCCCGTGGCCAGCTG
CGAACCATAGGCGCCACGACCTGGTCTGAATACAAGAAATATATCGAGAAAGATCCTGCGCTCACGCGCC
GATTTCAGCCTGTGCAGATTGCCGAGCCTTCAGAAGAGCAGGCGGTTGTCATGCTGCGTGGACTGGCGCG
CATTTTGGGCGAACATCACAAGGTGCTATTGCTTGACGAGGCCATTGACGCCGCGGTGCGCTTGTCTTAT
CGCTATATCCCGGCGCGGCAATTGCCGGATAAGGCCGTTGCCCTGCTTGATACTGCATGCGCCCGGGTAG
CGGTCAGCCAGCATGCCGTGCCGGCTGACCTGGAGGATTGCAGGCGCGAGATTGAAGCGCTGGAAATCGA
GCTCGATATGCTGGAGCGCGAGCAGAAACTGGGCATCGAACACCTGGTCCGCAATGAGCAGGTGCAGGCG
CGTTTGGCGTCCAGCCAGGAAAGGCTGGCTGTGCTGGACGGCCGCTGGCAGACCGAGCACGTGCTGGTAA
CGCAGCTGCATGGGCTGCAGACTGCCTTGCATGAAGCGGGATCGGAGCTTGATGAGCAGGTTCGCCTGCG
TGCAGAGCTGGACGAGCTGCGCCAGCAACTTGCCCGGCATCAGGGCGAGGCACCGCTTATTTTTCCGTCA
GTCGATGCGGCTGCCGTGGCAGCGGTAGTGGCCGAATGGACCGGTATTCCCGTAGGACGGATGCTGCGTG
ACGAGGCCGCTTCCGTGCTGCAACTGGCCGAAACGCTGGAGAAAAGGGTGGTGGGGCAGCGCCATGGGCT
TGACGCGATTGCCAGGCGCATAGAAACCTCGCGGGCCAAGCTGACTGATCCGAACAAGCCTGTGGGGGTC
TTCTTGCTGTGTGGGCCTAGCGGCGTAGGGAAAACGGAAACCGCCCTGGCACTGGCCGATACCCTGTATG
GTGGAGAACAGAATGTGATTGCCATCAATATGAGCGAGTTCCAGGAGTCTCATACTGTTTCAACGCTGAA
AGGTGCGCCACCGGGATACGTGGGTTACGGCGAGGGGGGGGGGCTGACGGAAGCAGTGCGGCGACGACCC
TATAGTGTGATTTTGCTCGACGAAGTCGAGAAAGCACACCCTGATGTACACGAAATCTTCTTCCAGGTCT
TTGACAAGGGCTGGATGGAGGATGGCGAGGGCCGTTATATCGACTTCAGACATACGGTCATCATTCTGAC
CTCTAACGTTGGTTCCGACCGCATGGCGGCCATGTGCCGCGATCCTGAGCAGTTGCCATCACCCGATCAG
TTACAGCAAGCCTTGCGCCAGCCTTTGCTGCAGATGTTTCCTGCCGCTTTGCTGGGGCGCTTGATTGTCG
TGCCGTATTACTCGCTGCCAGACAGCATGCTGGCGCAGATTGTGGTTTTGCAGCTGGAGCGGATACGTGC
TCGCCTGATGGACAACCATCAAGTACAGATGACGGTCCAGCCTGAAGTCATTGATCTGATTGTGGAGCGG
TGCACTGAGGTTGAGTCCGGCGGACGGATGATAGACAGCATACTGAGCAATACCGTTCTGCCCAGGGTGA
GTCGCGAGCTGCTCACCGCAGCGGTGGGCGCACAGTCTATCTCAGCGGTGACATTGGCTGCAGAAGACGG
TGAGTTTGTCTACCGGTTTTCGTGA