SecReT6
Protein ID: 332283603
SecReT6 ID436
T6SS typei3
Gene symbol-
Locus tagPT7_0350
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]410039..410773 [-]
Producthypothetical protein
NoteFha
UniProt IDF4GWL7
KEGG IDput:PT7_0350
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 4.20E-07, Aligned region: 24..90
Protein Sequence: 244 a.a.     [Download]
>gi|332283603|ref|YP_004415514.1| hypothetical protein PT7_0350 [Pusillimonas sp. T7-7]
MRLVATYIPTAQAAAFDFTEPGGTIGRCPGNHLLLSEDTRVGRIQAVVRIKDGAWSLKNVSSRADIMING
QALPLLQEIPIARGDTLMIGDYMLRAAVPSESAAAAEQITDPEPPAQESGQEAQDIARDDASDIFKELLD
GPGVLPVGQPAETGNLHPFELASQAPRNHPDPIQQMQGDHRSTAYSDVAYGPLNTEPERYDNHIFSNPTP
SALNFDDPLAPQRKNLIDEALAHGHASGAHHENR
 
Nucleotide Sequence: 735 bp     [Download]
>gi|332283253|ref|NC_015458.1|:c410773-410039 Pusillimonas sp. T7-7 chromosome, complete genome
ATGAGACTCGTTGCCACCTATATACCGACCGCACAGGCGGCCGCATTCGATTTCACGGAGCCGGGCGGCA
CGATAGGCCGATGCCCGGGCAACCACCTGCTGCTTAGTGAAGACACGCGCGTGGGTCGCATCCAGGCGGT
CGTTCGTATCAAGGATGGCGCCTGGAGCCTGAAAAATGTATCAAGCCGGGCAGACATCATGATCAATGGC
CAGGCTTTGCCACTGCTGCAGGAAATACCCATTGCCCGCGGCGATACCCTGATGATCGGCGACTACATGC
TGCGGGCTGCTGTCCCATCGGAATCAGCCGCAGCAGCAGAACAAATAACTGACCCGGAGCCACCGGCACA
AGAGTCAGGGCAGGAGGCCCAAGATATCGCTCGGGACGACGCCTCGGACATCTTCAAGGAGTTGCTGGAT
GGACCCGGTGTGCTGCCTGTGGGCCAGCCCGCTGAAACCGGTAATCTGCATCCCTTTGAGCTGGCCTCGC
AGGCGCCACGCAACCATCCCGACCCCATACAGCAGATGCAAGGCGATCATCGCTCGACGGCTTATAGCGA
CGTGGCATACGGGCCTTTGAACACTGAGCCCGAGCGCTACGACAACCATATCTTCAGCAATCCTACGCCC
AGCGCCCTGAATTTTGATGATCCCCTGGCGCCCCAGCGCAAGAATCTGATTGACGAAGCGCTGGCGCATG
GTCACGCCAGCGGCGCTCATCACGAAAACCGGTAG