SecReT6
Protein ID: 332283606
SecReT6 ID436
T6SS typei3
Gene symbol-
Locus tagPT7_0353
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]411987..413318 [+]
Producthypothetical protein
NoteTssK
UniProt IDF4GWM0
KEGG IDput:PT7_0353
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.60E-146, Aligned region: 18..442
Protein Sequence: 443 a.a.     [Download]
>gi|332283606|ref|YP_004415517.1| hypothetical protein PT7_0353 [Pusillimonas sp. T7-7]
MERKKVVWSEGMFLRPHHFQQLERHLEYRGSIHTECAAGLFWGFKTLQLDLDALALGKLALSQATGVFPD
GTPFDFDSPDDAPVALDLPAGTHNKRVMLVVPRQRRGGQDVSFEDDDDKLARYCVMEEEIADSSAVALGP
AVLQLGHLRLRLMLEDDVGGEWLALGVAVVLERRSDNRLLLDQAYIPPTLAAGLNTVLRAYIHELYGLLE
ARSELLVQRLAEPGRGGVSEVSEFLLLKTINRYRGALWHAQQLETLHPERLFHDFLMLASDLATFSAEGR
RLVSFPVYRHDELASSFEPVMVLLRRSLSAILEDKAIQIPLEDKGQGVRVAHISDVAMLRTAGLVLAVHA
QMPSELTRTRLPAQAKLGPIERIRDLVHLQLPGIALRPLPNVPKPLPYHAGYIYFELEKNGEMWKQFERS
GGLALHLAGDFPGLQLEFWAIRE
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|332283253|ref|NC_015458.1|:411987-413318 Pusillimonas sp. T7-7 chromosome, complete genome
ATGGAAAGAAAGAAGGTGGTTTGGTCCGAGGGCATGTTTCTGCGCCCTCATCATTTTCAACAACTGGAAC
GGCATCTTGAGTATCGAGGCAGCATCCATACGGAGTGTGCCGCAGGGCTATTCTGGGGTTTCAAGACCTT
GCAGCTGGACCTGGATGCACTTGCCCTGGGCAAGCTGGCACTGAGCCAGGCAACAGGCGTATTTCCTGAT
GGAACGCCTTTCGATTTTGACTCTCCGGACGATGCACCCGTGGCACTGGACCTGCCCGCAGGCACGCATA
ACAAGAGAGTCATGCTGGTCGTGCCCAGGCAACGTCGAGGCGGACAGGACGTGTCGTTTGAAGACGATGA
CGACAAGCTGGCGCGTTATTGCGTAATGGAAGAAGAGATCGCCGACTCAAGCGCGGTGGCATTGGGGCCC
GCGGTGCTGCAGTTGGGGCATTTGCGCTTGCGCCTGATGCTGGAAGACGATGTGGGCGGTGAGTGGCTCG
CACTGGGCGTTGCCGTTGTGCTTGAGCGGCGCAGCGACAACCGCCTGTTGCTGGACCAGGCCTATATTCC
TCCGACCCTGGCTGCAGGCCTTAATACAGTGTTGCGTGCGTATATCCATGAGCTTTATGGCTTGCTGGAA
GCGCGCAGCGAATTGCTGGTGCAGAGGCTGGCCGAACCAGGGCGGGGCGGTGTATCGGAGGTGTCGGAAT
TCCTGCTGCTTAAAACAATCAATCGCTATCGCGGCGCACTGTGGCACGCGCAGCAGCTGGAAACCTTGCA
TCCGGAGCGCCTGTTTCATGACTTCCTTATGCTGGCCAGCGACTTGGCAACATTTTCCGCTGAGGGGCGA
CGCCTTGTGTCATTCCCCGTGTATCGACACGATGAGCTGGCTTCCAGTTTCGAGCCCGTGATGGTGCTGC
TGCGCCGTTCCCTATCAGCCATTCTCGAGGACAAAGCCATACAGATTCCGCTCGAGGACAAAGGCCAGGG
TGTCAGGGTGGCGCATATCAGCGACGTGGCCATGTTGCGTACAGCCGGGCTGGTGCTGGCCGTACATGCC
CAGATGCCGTCCGAGCTGACACGCACGCGTTTGCCCGCCCAAGCCAAGCTGGGCCCTATAGAGCGTATTC
GCGATCTGGTGCATTTGCAGCTGCCCGGGATTGCGCTGCGACCCCTGCCCAATGTGCCCAAGCCTTTGCC
TTATCACGCAGGTTATATCTACTTCGAGCTGGAAAAGAACGGAGAAATGTGGAAGCAGTTCGAACGCTCC
GGTGGCCTGGCCTTGCACTTGGCGGGCGATTTTCCCGGCCTTCAACTTGAGTTCTGGGCAATACGTGAAT
GA