SecReT6
Protein ID: 332283607
SecReT6 ID436
T6SS typei3
Gene symbol-
Locus tagPT7_0354
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]413315..414646 [+]
Producthypothetical protein
NoteTssL
UniProt IDF4GWM1
KEGG IDput:PT7_0354
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.90E-70, Aligned region: 46..251
DUF2077 [PF09850], Evalue: 1.90E-70, Aligned region: 392..420
OmpA [PF00691], Evalue: 4.90E-18, Aligned region: 320..418
Protein Sequence: 443 a.a.     [Download]
>gi|332283607|ref|YP_004415518.1| hypothetical protein PT7_0354 [Pusillimonas sp. T7-7]
MMQGSFSMASPNNDLGNAGYPADAGFPPRHDERLWPGEHTFSGSSNTLVAAANSLLVLIPQIRATATHPS
PQLLREHLLDEVRQFEMRAQQVGIPNETILGARYCLCTALDEAAALTPWGGGGVWSAHSLLVTFHNETWG
GEKFFQLLAKLSQNPRQHIDLLELLYYCLMLGFEGRYRVADNGRSQLDTVRQRLLLILRDVRGEYASALS
PHWHDAPLLAQVRRLPVPLWVFASIAAAIGLFAYFGLSWSLSGKSDVVYASMSGLKPPVLPAPAPKAPDP
QPVPFGRALTGFLAPEIRENLLAVRNEVDRSVIILHGDGLFTSGSDELRSEYIPVLSRVADALNQSRGSI
LVSGYSDNVPIRTVRFPSNWELSQARADAVKALLQDRLTQPERVRAEGRGDANPVAPNNTPANRARNRRV
EITLLVSPVDGGAGSPLRAGGQP
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|332283253|ref|NC_015458.1|:413315-414646 Pusillimonas sp. T7-7 chromosome, complete genome
ATGATGCAAGGAAGCTTTTCCATGGCCTCGCCGAATAATGACTTGGGTAATGCCGGGTATCCGGCGGATG
CCGGTTTTCCGCCGCGCCACGACGAGCGCTTGTGGCCCGGCGAGCACACGTTTTCCGGATCGAGCAACAC
TTTGGTTGCCGCCGCCAATTCGCTATTGGTGTTGATACCGCAGATCCGTGCCACGGCAACACACCCTTCG
CCGCAGTTGTTGCGCGAGCACTTGCTGGATGAGGTACGGCAGTTCGAGATGAGGGCGCAGCAGGTCGGCA
TACCGAACGAAACCATCCTGGGGGCGCGCTACTGTTTATGTACCGCGCTGGACGAGGCGGCGGCGCTTAC
GCCCTGGGGCGGAGGCGGGGTGTGGTCGGCCCACAGCCTGTTGGTGACTTTCCATAATGAAACCTGGGGC
GGCGAAAAATTCTTTCAATTGCTCGCCAAGCTATCGCAAAACCCCAGGCAGCATATCGATCTGCTTGAGC
TGTTGTATTACTGCCTGATGCTCGGCTTTGAAGGCAGGTACCGGGTGGCGGACAATGGTCGCAGCCAGCT
CGATACGGTAAGGCAAAGGTTGTTGCTGATATTACGTGATGTGCGCGGCGAGTATGCAAGCGCGTTGTCG
CCGCATTGGCATGATGCGCCCTTGCTGGCTCAGGTAAGGCGGCTGCCCGTACCCTTGTGGGTATTTGCCT
CGATCGCGGCTGCCATAGGCTTGTTTGCCTATTTCGGTTTGAGCTGGAGCCTGAGCGGCAAGTCCGATGT
TGTGTATGCGTCCATGTCCGGACTCAAACCACCCGTGCTGCCTGCGCCGGCGCCCAAGGCGCCAGATCCT
CAGCCTGTGCCGTTTGGCCGGGCGTTGACAGGATTTCTGGCGCCGGAAATCAGGGAGAACTTGCTGGCTG
TGCGTAATGAAGTAGATCGCAGTGTCATCATTCTTCATGGCGATGGTTTGTTCACATCGGGCTCGGATGA
GTTGCGGTCCGAATATATTCCCGTTCTGTCACGGGTTGCCGACGCCTTGAATCAATCCCGGGGCAGTATT
CTGGTCAGCGGTTATAGCGATAACGTGCCAATACGTACCGTACGCTTCCCTTCCAACTGGGAGCTCTCGC
AGGCGCGTGCGGATGCGGTCAAGGCGCTGCTGCAAGACCGCCTGACGCAGCCTGAGCGGGTCAGGGCCGA
AGGACGAGGGGATGCCAATCCTGTGGCGCCCAACAATACGCCGGCCAATCGGGCCAGGAATCGCCGGGTT
GAGATTACGCTGCTGGTGTCCCCGGTAGATGGCGGGGCGGGAAGTCCCTTGCGGGCAGGGGGGCAGCCAT
GA