SecReT6
Protein ID: 332283612
SecReT6 ID436
T6SS typei3
Gene symbol-
Locus tagPT7_0359
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]421196..423544 [+]
Producthypothetical protein
NoteTssI
UniProt IDF4GWM6
KEGG IDput:PT7_0359
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.60E-87, Aligned region: 24..327
Phage_GPD [PF05954], Evalue: 5.60E-87, Aligned region: 538..565
Phage_GPD [PF05954], Evalue: 5.60E-87, Aligned region: 705..751
Phage_base_V [PF04717], Evalue: 1.40E-23, Aligned region: 366..459
Protein Sequence: 782 a.a.     [Download]
>gi|332283612|ref|YP_004415523.1| hypothetical protein PT7_0359 [Pusillimonas sp. T7-7]
MNRTVKVSTSLPGDTLIFRSLHGEEELSTLFEFEVEMLSESHSLDLKQLLSQPLTMSIDLGMAGTRYLNG
QVIRCKLIGRASATSRYYIYRAVVRPWLWYLTQTTDSKIFQEKSVPDVIREVLADYEFPSEFKLTGSYRT
WEYCVQYQETDFAFISRLMEHEGIYYWFRHEDGKHVLVLTDDVSQQEPFPGLETLPYIGPDRVVQPDKEH
ISRWEPAEQVTPGKFATVDYDFKKPAASLDALRSNPGAYANGDLEVYEWMGGYTEPDQGEHYSQVRLEAL
QAQQSQVTGHSNAHALAPGRLLTLFNHPRQVENREYLIQKVVYHVQESDYSSTGDDISQFEVDFAAIPSS
LPFRPARVTPLPRTHGPQTARVVGKPGEQIWTDRYGCVKVQFRWDRYGQTNENSSCWVRVSSPWAGGGFG
GIQLPRVDDEVIVDFIGGHPDRPIIIGRVFNASNMPPWDLPGNATQSGFLSRSKDGDRNTANALMFEDVA
GGERIWLHAERDLTTEVEANELHTVDGDRNTVIAGNDTLTVMAARTSTTQGQETEIFMAGADRTVTGAVN
ETITGDETRSVTGNVIETIAGNVDETITGNLTQTTTGDVTRTITGPVVDTTTGTVDETITGDHTQTTTGT
VTRTITGDVTDTVTGAVTHTVTGDTTSTLTGTLTKTVTGAVTVNADTGVTVTTPSWTLNNTGPTAFWQAM
YAKGTPARFTVTGAAADLWGLRGQAYVLNLQYAVVKLDFFDFKNDNGQIELTQKLAKVSMTAAAKLSTGG
MNLYSKVMNIFL
 
Nucleotide Sequence: 2349 bp     [Download]
>gi|332283253|ref|NC_015458.1|:421196-423544 Pusillimonas sp. T7-7 chromosome, complete genome
GTGAACCGTACCGTTAAAGTCAGCACATCATTACCCGGCGATACTTTGATCTTCCGCTCGCTCCATGGCG
AGGAAGAACTGTCGACCCTGTTCGAGTTCGAAGTGGAAATGTTGTCTGAGTCTCATTCTCTGGACCTGAA
GCAGTTGCTTAGCCAGCCTCTGACAATGAGTATTGACCTGGGTATGGCGGGTACCCGGTATTTGAATGGG
CAGGTCATACGCTGCAAGTTGATAGGCCGGGCCAGCGCAACCTCGCGCTATTACATCTATCGTGCCGTTG
TGCGCCCTTGGCTGTGGTACCTGACGCAGACCACTGACAGCAAGATTTTCCAGGAAAAATCAGTGCCGGA
TGTCATTCGTGAGGTACTGGCCGATTATGAGTTTCCCAGCGAGTTCAAGCTGACTGGCAGCTATCGCACC
TGGGAGTATTGTGTTCAGTATCAGGAAACCGATTTTGCCTTTATCAGCCGTCTGATGGAGCATGAAGGCA
TTTATTACTGGTTCAGGCATGAAGACGGCAAGCATGTATTGGTGCTGACTGATGATGTTTCCCAGCAGGA
GCCATTTCCCGGTCTAGAAACCCTGCCTTACATTGGACCGGATCGCGTCGTGCAGCCCGACAAGGAACAT
ATTTCACGCTGGGAGCCTGCCGAACAGGTGACACCGGGCAAGTTCGCCACGGTGGACTACGATTTCAAGA
AGCCGGCGGCAAGTCTGGATGCGCTGCGCAGCAATCCAGGCGCCTATGCGAATGGTGATCTGGAAGTCTA
CGAGTGGATGGGCGGTTATACCGAGCCTGATCAGGGCGAGCATTATTCACAGGTACGGCTTGAAGCATTG
CAGGCACAGCAGTCGCAGGTTACAGGGCACAGCAATGCACACGCGCTAGCTCCTGGCCGTTTGCTGACTT
TGTTCAATCACCCGCGCCAGGTCGAGAATCGCGAGTACTTGATTCAGAAAGTGGTTTATCACGTGCAGGA
AAGCGACTATTCCAGCACCGGGGATGATATCAGTCAGTTTGAAGTCGATTTTGCGGCTATCCCGTCCAGC
TTGCCGTTTCGTCCCGCCCGGGTTACGCCTTTGCCGCGCACCCATGGGCCGCAGACAGCAAGGGTGGTGG
GCAAGCCCGGTGAGCAGATATGGACTGACCGTTATGGTTGCGTCAAGGTGCAGTTCCGCTGGGATCGCTA
CGGGCAAACCAACGAAAACAGCTCATGCTGGGTGCGTGTGTCCAGCCCTTGGGCGGGCGGCGGCTTTGGC
GGTATTCAACTGCCGCGTGTTGATGATGAGGTTATTGTGGACTTCATTGGGGGGCACCCCGATCGGCCCA
TCATTATTGGCCGGGTCTTCAACGCCAGCAATATGCCGCCCTGGGATCTGCCCGGCAATGCCACGCAAAG
CGGCTTCCTGAGCCGCTCCAAGGACGGCGACCGCAATACCGCCAATGCCTTGATGTTTGAGGACGTGGCC
GGCGGCGAGCGTATCTGGCTGCATGCGGAGCGTGATCTGACGACCGAAGTCGAGGCTAACGAACTGCATA
CGGTGGATGGCGACCGCAACACCGTCATTGCTGGTAATGACACCTTGACAGTGATGGCTGCACGCACCAG
CACAACCCAGGGGCAGGAAACCGAAATCTTCATGGCGGGGGCTGATCGCACCGTGACCGGGGCGGTCAAT
GAAACCATTACGGGTGACGAGACGCGCAGTGTGACCGGCAATGTGATCGAAACGATTGCAGGCAATGTCG
ATGAAACCATTACCGGCAACCTGACACAGACGACGACAGGTGATGTGACGCGCACCATTACTGGACCCGT
CGTGGACACGACAACCGGTACGGTGGATGAAACGATTACCGGTGATCATACGCAAACAACAACCGGTACT
GTGACACGAACAATTACCGGCGACGTCACTGACACGGTAACGGGCGCTGTCACCCATACGGTAACGGGCG
ATACCACAAGCACCCTGACGGGCACGCTGACTAAAACCGTGACGGGCGCCGTGACCGTCAATGCCGATAC
GGGCGTTACGGTGACCACACCTTCATGGACGTTGAACAATACGGGGCCCACTGCGTTCTGGCAGGCGATG
TACGCGAAAGGCACGCCGGCCAGGTTCACGGTGACGGGCGCCGCCGCCGATCTATGGGGGCTCAGGGGAC
AAGCTTATGTTCTTAACCTGCAGTATGCGGTGGTCAAGCTCGATTTTTTTGACTTCAAGAATGATAACGG
CCAGATTGAGCTTACCCAGAAGCTGGCCAAGGTGTCCATGACTGCCGCGGCAAAACTCAGCACGGGCGGT
ATGAATCTGTACAGCAAAGTAATGAACATATTTCTTTAA