SecReT6
Protein ID: 332285580
SecReT6 ID437
T6SS typei1
Gene symbol-
Locus tagPT7_2327
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]2484271..2484942 [-]
Producthypothetical protein
NoteTssL
UniProt IDF4GSD6
KEGG IDput:PT7_2327
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.00E-37, Aligned region: 19..208
Protein Sequence: 223 a.a.     [Download]
>gi|332285580|ref|YP_004417491.1| hypothetical protein PT7_2327 [Pusillimonas sp. T7-7]
MRLASYWIPRMESAYAAFRQSDAEVESIVEQLKALLDQASAQARRDGYPPEHVQDALYATVAWIDELAMS
FEWPGSAVWRLSPLQRHYFATTRAGVGFFERLQALPEQANEVREVFALMLVAGFQGDFAHRPAAELDQFR
SELLERVAQEVGMAPLGGGQLLFPEAYALGKQVTISRRPGGPSTAVILMILLPLLVLLGLYVYLNTQLLY
DTAELVKPLTKGL
 
Nucleotide Sequence: 672 bp     [Download]
>gi|332283253|ref|NC_015458.1|:c2484942-2484271 Pusillimonas sp. T7-7 chromosome, complete genome
ATGCGTCTTGCCAGCTATTGGATACCCAGGATGGAATCGGCGTACGCGGCTTTCCGGCAAAGTGATGCAG
AGGTGGAAAGCATTGTTGAACAGCTCAAGGCGTTGCTGGATCAGGCCAGTGCGCAAGCCAGGCGTGACGG
TTATCCGCCCGAGCATGTACAGGATGCCCTGTACGCAACAGTGGCATGGATAGACGAACTGGCCATGTCG
TTTGAATGGCCAGGATCGGCAGTATGGCGGCTATCTCCGCTGCAGCGTCATTACTTTGCCACGACGCGTG
CGGGTGTGGGCTTCTTCGAGCGCTTGCAGGCTTTGCCTGAGCAGGCGAATGAAGTGCGAGAGGTATTCGC
CTTGATGCTGGTGGCTGGATTTCAAGGTGATTTCGCCCATAGGCCTGCTGCCGAACTGGATCAGTTTCGT
AGCGAGTTGCTGGAAAGGGTGGCGCAAGAGGTCGGTATGGCCCCTTTGGGTGGTGGCCAGCTTTTGTTTC
CCGAAGCTTATGCACTTGGAAAGCAGGTAACGATAAGCAGGCGTCCTGGCGGGCCATCGACGGCAGTCAT
TTTGATGATTCTGCTGCCATTGCTTGTTTTGCTTGGATTGTATGTGTATTTGAACACACAGCTGCTCTAC
GATACGGCAGAGTTGGTCAAGCCTTTGACCAAAGGGCTTTAA