SecReT6
Protein ID: 332285581
SecReT6 ID437
T6SS typei1
Gene symbol-
Locus tagPT7_2328
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]2484947..2486344 [-]
Producthypothetical protein
NoteTssK
UniProt IDF4GSD7
KEGG IDput:PT7_2328
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 7.10E-90, Aligned region: 21..463
Protein Sequence: 465 a.a.     [Download]
>gi|332285581|ref|YP_004417492.1| hypothetical protein PT7_2328 [Pusillimonas sp. T7-7]
MTTQLKPAIFWHQGLFLEPQHFQHQDAKLERALERHLELTTPWAWGFYTLQLDESALQAHSLSISHVAVR
WKDGAFTEFPGNARVESRRFELTDFAQGPRKAYLGLRRLMEDEVNVLRYEHIESAAQSHSRFAALADPQQ
VPDMYSDGASGHVAVMNYVLRIFWEDEIENLGDYELMPLVCLEQSGEAVHPLPTFTPPCMTLAAAPQLQR
LLNELRDEIIGRARQLEVFKRPLASREQEGDAQLSTMLALSVLNRYGSQLNHLVEGLQTHPWFVYGVLRQ
LIGELSTFTEYCDLLGETRDSQSLLQPYEHNGLGAVFDSVRALLFRLLNEITLGPEMFVRFERDGAADTL
YRAELPSNFFGTRHRYYLMVRSALEAAETTGLMMLEGKLAPLESMEMTVNRALPGIELIPLQTLPLGMPR
RSGAAYFRVESQSELWDAVAEDGRLALFLPNPPEELRVELIVIKG
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|332283253|ref|NC_015458.1|:c2486344-2484947 Pusillimonas sp. T7-7 chromosome, complete genome
ATGACCACGCAACTTAAACCAGCCATTTTCTGGCATCAGGGACTCTTCCTGGAACCACAACACTTCCAGC
ATCAGGACGCGAAACTGGAGCGTGCGCTGGAGCGCCATCTGGAATTGACCACTCCATGGGCCTGGGGCTT
TTACACATTGCAGCTTGATGAGTCTGCATTGCAAGCCCACAGCCTGAGCATCAGTCATGTGGCGGTACGC
TGGAAAGACGGCGCGTTTACCGAGTTCCCCGGTAATGCCCGGGTGGAATCACGCCGCTTCGAGCTGACAG
ACTTCGCACAGGGTCCGCGCAAGGCCTATTTGGGTCTGCGCAGGTTGATGGAAGATGAAGTCAATGTGCT
GCGTTATGAGCATATCGAGAGTGCAGCGCAAAGCCATTCGCGCTTTGCTGCACTGGCAGATCCACAACAA
GTGCCAGACATGTATTCCGACGGTGCATCCGGGCATGTTGCCGTGATGAACTATGTGCTCAGGATTTTCT
GGGAAGACGAAATCGAAAATCTGGGTGACTACGAGCTGATGCCTTTGGTGTGCTTGGAACAGAGCGGGGA
AGCGGTGCACCCGTTGCCGACTTTTACCCCGCCCTGCATGACTTTGGCTGCAGCGCCCCAACTGCAGCGT
TTGCTGAACGAATTACGTGACGAAATTATCGGCCGGGCACGTCAGCTGGAAGTGTTCAAGAGGCCCTTGG
CCAGTCGCGAGCAGGAAGGCGATGCACAGTTGAGCACCATGCTGGCCTTATCGGTGCTCAACCGATATGG
CTCCCAGCTCAACCACTTGGTCGAAGGTCTTCAAACCCATCCATGGTTTGTGTATGGTGTATTGCGTCAA
CTGATTGGCGAGCTGAGCACCTTTACCGAATATTGCGACCTGCTGGGCGAGACTCGTGATAGCCAGTCTT
TGCTGCAACCCTATGAACATAACGGCCTGGGGGCGGTTTTCGATAGCGTTCGCGCATTGCTGTTCCGCTT
GCTCAACGAGATAACACTGGGGCCGGAAATGTTTGTGCGGTTCGAGCGTGATGGCGCTGCCGACACTTTG
TACCGCGCCGAACTGCCATCCAACTTCTTTGGTACCAGGCATCGCTATTACCTGATGGTAAGAAGCGCCC
TGGAAGCTGCTGAGACAACTGGTTTGATGATGCTGGAAGGCAAGCTGGCTCCGCTTGAAAGCATGGAGAT
GACGGTGAACCGTGCCTTGCCTGGAATCGAGCTGATTCCGCTGCAGACGCTGCCCTTGGGCATGCCGCGA
CGTAGTGGCGCTGCTTATTTCAGGGTGGAAAGCCAATCTGAACTATGGGATGCCGTGGCCGAAGATGGCC
GCCTGGCCTTGTTTTTGCCCAATCCGCCTGAAGAGCTGCGTGTTGAGCTGATCGTAATCAAAGGATAG