SecReT6
Protein ID: 332285582
SecReT6 ID437
T6SS typei1
Gene symbol-
Locus tagPT7_2329
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]2486341..2487048 [-]
Producthypothetical protein
NoteTssJ
UniProt IDF4GSD8
KEGG IDput:PT7_2329
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.10E-22, Aligned region: 21..164
Protein Sequence: 235 a.a.     [Download]
>gi|332285582|ref|YP_004417493.1| hypothetical protein PT7_2329 [Pusillimonas sp. T7-7]
MITVSLIPNALTRWLIAAVCCAVLAGCGTSEKEALKELKWSYSDDGVQIQVQADPALNQAKGQPHMLTLV
VVQMEDPNGFTALTSNAAKLKTLLLSDSPPQGVLSIKRIFIAPGETRSLKLERVEKAQYIGLAAGYDHLD
PARCTRLYRVGVEVDSSGLIIKSRTATPEPLKIELRLGPDGIQESPGSKPQPVEPTKPKAGLVPAPAPAT
TPASAPVSAPATGSPTSNVTPSDAK
 
Nucleotide Sequence: 708 bp     [Download]
>gi|332283253|ref|NC_015458.1|:c2487048-2486341 Pusillimonas sp. T7-7 chromosome, complete genome
ATGATAACCGTGAGTCTCATACCCAATGCCTTGACCCGCTGGTTGATTGCTGCCGTCTGCTGCGCCGTGT
TGGCGGGTTGCGGTACGTCCGAGAAAGAAGCTTTGAAGGAATTGAAATGGAGTTACTCGGACGACGGTGT
TCAGATCCAGGTGCAAGCCGATCCTGCTCTGAATCAGGCCAAAGGCCAGCCGCACATGTTGACGCTTGTG
GTGGTACAGATGGAAGACCCTAACGGCTTTACCGCCTTGACCAGCAATGCCGCCAAACTGAAAACACTGC
TGCTGTCCGACAGTCCGCCGCAAGGTGTACTGTCCATCAAGCGAATTTTTATAGCCCCAGGCGAAACCCG
CAGCCTGAAACTGGAGCGGGTCGAGAAAGCCCAGTACATAGGCCTGGCTGCCGGTTATGACCACCTGGAC
CCAGCCCGTTGTACGCGTCTTTACCGTGTGGGGGTCGAGGTGGACTCATCCGGACTCATCATCAAGTCAC
GTACTGCAACGCCCGAGCCTCTCAAAATCGAGCTGCGCCTTGGACCTGACGGTATACAAGAGTCTCCGGG
TAGCAAGCCCCAGCCTGTCGAGCCAACCAAGCCCAAGGCCGGGCTGGTGCCAGCGCCGGCTCCCGCTACC
ACGCCGGCTTCAGCGCCGGTTTCAGCGCCGGCAACAGGCTCGCCCACTTCCAACGTAACACCTTCGGATG
CCAAATGA