SecReT6
Protein ID: 332285587
SecReT6 ID437
T6SS typei1
Gene symbol-
Locus tagPT7_2334
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]2491681..2494176 [-]
Producthypothetical protein
NoteTssI
UniProt IDF4GSE3
KEGG IDput:PT7_2334
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.00E-37, Aligned region: 32..354
Phage_GPD [PF05954], Evalue: 1.00E-37, Aligned region: 418..471
Phage_base_V [PF04717], Evalue: 7.20E-14, Aligned region: 423..504
Protein Sequence: 831 a.a.     [Download]
>gi|332285587|ref|YP_004417498.1| hypothetical protein PT7_2334 [Pusillimonas sp. T7-7]
MTDSIFDYSLQCQALQELLPKEDILVTQWHGTEAVSRPYRFDITIAVRGASLQLESLLDKPATLSLRRPD
GSVARWHGIITQGSEHGHDEVYDYYQLVLEPRLVRLALRQWSDIYLDQQLDDLIESLLRQGQLSEKYFSD
DSPYDYRIAVQGQDLSSMRRPFVCQFEESCLDFLMRKLEYYGVYFWFEQGEDRESIVFANDASQQPAQVD
NAIYYPKGVLDPDTRQIVLTRMDRRVTMRPAAVSLRALHEPQNTLLHLQAGADVPASYPGQGEIYSAADH
FAVLDSDSTGANGVPGDTLARWRAQELACQSLGVQGDARTPGVNAGRFLAVSVFQQAADTSQYYIVQVEH
QGTQTLDTAPGSDTPSYLARFTALPRWRDQARQDDPVQFRPERRTPVPRVTRLMSGFVDMDDEAGAKRYA
QPDDQGRYKVRLAFTRQRYDSYRNSAWLRLSTPYAAGASQKGLAAAGMHFPLREGTEVLIAFLNGDPDMP
VIVGSLPNAEAPSVVNQANPREHVLRTPGGTGFTFLDGASAVQLTSASEEEGDESSDVESNPEGYEADDS
RVTISAPTAEAKLNLGAPEEADGKEGFLLTTAANGEIYSGESILIEVPGKLTICAGGKDFISNKVDWELS
SPNGHAVIENTMALNVGNYIGGKVEVMEGLDVSATFGLASELFVGAKAEACISASADFTFGPAKEWKFVR
KQECTAWSSTLKKSWKRWCLEENSHSEEITNNSLTYETNAFVSYEVKSPSVTIGQSQSYLSIDLLDSTLA
GGSTTIKSRHATYIESDFVVNVTCGPSKIDLNSVNTELSAPVLRFNGETMTEMVSALIKLG
 
Nucleotide Sequence: 2496 bp     [Download]
>gi|332283253|ref|NC_015458.1|:c2494176-2491681 Pusillimonas sp. T7-7 chromosome, complete genome
ATGACTGACAGTATCTTCGATTACTCTTTGCAGTGCCAAGCGCTGCAGGAGTTGCTTCCCAAAGAGGATA
TTCTGGTTACGCAATGGCACGGTACCGAGGCGGTTTCACGACCCTATCGCTTCGACATCACCATAGCCGT
GCGCGGCGCCAGCCTGCAGCTTGAGAGCCTGCTGGACAAGCCGGCCACGCTCAGCCTGCGCCGACCCGAT
GGTTCTGTTGCGCGGTGGCATGGCATCATCACCCAGGGCTCAGAGCATGGTCATGATGAAGTTTATGACT
ACTATCAACTGGTACTCGAACCACGACTGGTGCGTCTGGCTTTGCGCCAGTGGTCGGATATCTATCTGGA
CCAACAGTTGGATGATCTGATCGAAAGCCTGCTTCGGCAAGGGCAGCTTTCCGAAAAATACTTCAGCGAT
GACTCTCCTTACGATTACCGGATAGCGGTACAGGGGCAAGACCTGTCGTCCATGCGCCGCCCGTTTGTGT
GTCAGTTTGAAGAAAGTTGCCTGGATTTCCTGATGCGCAAGCTCGAGTACTACGGCGTGTACTTCTGGTT
CGAACAGGGCGAGGATCGTGAGTCTATCGTCTTTGCGAATGATGCATCTCAGCAGCCAGCACAAGTGGAC
AACGCCATCTATTATCCCAAGGGTGTGCTGGATCCGGATACGCGCCAGATCGTGCTGACCCGCATGGACA
GAAGAGTAACCATGCGTCCCGCCGCAGTCTCGCTGCGTGCGCTGCACGAACCCCAGAACACGCTGCTTCA
TCTGCAAGCAGGAGCCGATGTACCTGCCTCTTATCCTGGCCAAGGCGAAATCTACAGCGCCGCCGACCAT
TTTGCCGTGCTCGACAGCGACAGCACTGGCGCCAATGGCGTGCCGGGTGACACGTTGGCGCGCTGGCGGG
CCCAGGAGCTGGCCTGCCAAAGCCTGGGTGTACAGGGCGATGCGCGAACCCCTGGCGTGAATGCGGGCCG
CTTCCTGGCGGTATCGGTGTTTCAACAAGCGGCCGATACCAGTCAGTATTACATCGTCCAGGTTGAGCAT
CAGGGGACGCAGACGCTGGACACCGCGCCCGGCAGTGATACGCCGTCCTATCTGGCGCGCTTTACCGCTT
TGCCTCGCTGGCGCGACCAGGCCCGGCAAGATGATCCCGTACAGTTTCGTCCTGAACGTAGAACGCCAGT
GCCACGCGTGACGCGCTTGATGTCGGGCTTCGTAGATATGGATGACGAGGCCGGCGCCAAGCGCTATGCC
CAGCCGGACGATCAGGGGCGCTACAAAGTGAGGCTGGCCTTTACGCGCCAGCGCTACGACAGCTACCGCA
ACTCGGCCTGGCTGCGTTTGAGTACTCCGTACGCTGCCGGCGCTTCCCAGAAAGGCCTGGCTGCAGCGGG
CATGCATTTCCCGCTGCGCGAGGGAACCGAAGTGCTGATTGCTTTTCTGAACGGCGACCCCGACATGCCG
GTCATTGTGGGGTCCTTGCCCAATGCCGAAGCCCCCAGCGTCGTCAACCAGGCCAACCCGCGCGAGCATG
TATTGCGTACACCTGGGGGTACCGGCTTTACCTTTCTGGATGGCGCTTCAGCTGTACAACTCACTTCTGC
ATCCGAAGAGGAAGGGGATGAGTCTTCTGACGTCGAGAGCAATCCCGAGGGTTATGAGGCTGATGATTCT
CGCGTGACGATTTCTGCGCCCACTGCCGAGGCAAAGCTGAATCTGGGCGCACCCGAAGAAGCAGACGGGA
AGGAAGGTTTCCTGCTGACCACGGCCGCAAACGGAGAGATCTATTCCGGCGAAAGCATATTGATTGAAGT
GCCAGGAAAATTGACGATCTGCGCAGGAGGCAAGGATTTTATTTCCAATAAAGTGGACTGGGAGTTGAGC
AGCCCTAACGGCCATGCTGTCATTGAAAATACGATGGCGCTCAATGTGGGGAATTACATAGGCGGAAAGG
TCGAGGTCATGGAAGGGCTCGATGTGTCCGCAACCTTTGGGCTTGCATCTGAGCTCTTTGTAGGAGCGAA
GGCCGAGGCTTGCATCAGTGCGAGCGCGGATTTTACATTCGGACCGGCAAAAGAGTGGAAGTTCGTACGA
AAGCAGGAGTGCACCGCCTGGTCCTCCACGCTTAAGAAAAGCTGGAAGCGCTGGTGCCTGGAAGAAAACT
CCCATTCCGAGGAAATTACGAACAACTCGCTGACGTACGAAACCAATGCTTTCGTTAGCTACGAGGTCAA
AAGTCCTTCCGTCACGATAGGGCAATCGCAGTCCTACCTTTCCATAGATCTTCTCGATTCGACCCTGGCG
GGGGGGAGCACCACCATCAAGTCCAGGCATGCTACGTATATCGAGAGTGACTTCGTGGTGAATGTCACTT
GCGGCCCGTCCAAGATCGACCTGAACAGCGTCAATACGGAACTTTCGGCCCCAGTGTTGAGATTCAACGG
CGAAACCATGACGGAAATGGTAAGCGCACTGATAAAGCTAGGCTAG