SecReT6
Protein ID: 332285588
SecReT6 ID437
T6SS typei1
Gene symbol-
Locus tagPT7_2335
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]2494173..2496845 [-]
ProductATPase AAA
NoteTssH
UniProt IDF4GSE4
KEGG IDput:PT7_2335
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.70E-41, Aligned region: 224..241
AAA_2 [PF07724], Evalue: 2.70E-41, Aligned region: 603..767
AAA [PF00004], Evalue: 7.00E-22, Aligned region: 225..356
AAA [PF00004], Evalue: 7.00E-22, Aligned region: 608..731
AAA_16 [PF13191], Evalue: 2.60E-14, Aligned region: 201..255
AAA_16 [PF13191], Evalue: 2.60E-14, Aligned region: 268..302
AAA_16 [PF13191], Evalue: 2.60E-14, Aligned region: 368..449
AAA_16 [PF13191], Evalue: 2.60E-14, Aligned region: 579..646
AAA_16 [PF13191], Evalue: 2.60E-14, Aligned region: 672..701
ClpB_D2-small [PF10431], Evalue: 4.70E-14, Aligned region: 777..846
AAA_5 [PF07728], Evalue: 1.40E-13, Aligned region: 226..246
AAA_5 [PF07728], Evalue: 1.40E-13, Aligned region: 283..354
AAA_5 [PF07728], Evalue: 1.40E-13, Aligned region: 607..725
AAA_22 [PF13401], Evalue: 3.00E-09, Aligned region: 223..305
AAA_22 [PF13401], Evalue: 3.00E-09, Aligned region: 605..700
AAA_19 [PF13245], Evalue: 8.70E-07, Aligned region: 219..245
AAA_19 [PF13245], Evalue: 8.70E-07, Aligned region: 605..633
IstB_IS21 [PF01695], Evalue: 3.60E-05, Aligned region: 218..249
IstB_IS21 [PF01695], Evalue: 3.60E-05, Aligned region: 607..629
Sigma54_activat [PF00158], Evalue: 4.00E-05, Aligned region: 219..238
Sigma54_activat [PF00158], Evalue: 4.00E-05, Aligned region: 607..724
Arch_ATPase [PF01637], Evalue: 0.00019, Aligned region: 202..238
Arch_ATPase [PF01637], Evalue: 0.00019, Aligned region: 276..321
Arch_ATPase [PF01637], Evalue: 0.00019, Aligned region: 602..621
Arch_ATPase [PF01637], Evalue: 0.00019, Aligned region: 678..698
AAA_17 [PF13207], Evalue: 0.00033, Aligned region: 226..248
AAA_17 [PF13207], Evalue: 0.00033, Aligned region: 607..642
AAA_25 [PF13481], Evalue: 0.0004, Aligned region: 224..254
AAA_25 [PF13481], Evalue: 0.0004, Aligned region: 603..635
AAA_14 [PF13173], Evalue: 0.00043, Aligned region: 283..339
AAA_14 [PF13173], Evalue: 0.00043, Aligned region: 606..689
AAA_14 [PF13173], Evalue: 0.00043, Aligned region: 818..846
Zeta_toxin [PF06414], Evalue: 0.00063, Aligned region: 224..241
Zeta_toxin [PF06414], Evalue: 0.00063, Aligned region: 606..647
TIP49 [PF06068], Evalue: 0.0013, Aligned region: 225..250
TIP49 [PF06068], Evalue: 0.0013, Aligned region: 271..304
TIP49 [PF06068], Evalue: 0.0013, Aligned region: 607..643
Clp_N [PF02861], Evalue: 0.0013, Aligned region: 29..74
RuvB_N [PF05496], Evalue: 0.0031, Aligned region: 224..239
RuvB_N [PF05496], Evalue: 0.0031, Aligned region: 292..304
RuvB_N [PF05496], Evalue: 0.0031, Aligned region: 577..628
AAA_18 [PF13238], Evalue: 0.004, Aligned region: 226..245
AAA_18 [PF13238], Evalue: 0.004, Aligned region: 608..642
ResIII [PF04851], Evalue: 0.008, Aligned region: 208..246
ResIII [PF04851], Evalue: 0.008, Aligned region: 289..305
ResIII [PF04851], Evalue: 0.008, Aligned region: 578..630
NACHT [PF05729], Evalue: 0.0093, Aligned region: 225..251
NACHT [PF05729], Evalue: 0.0093, Aligned region: 608..633
Protein Sequence: 890 a.a.     [Download]
>gi|332285588|ref|YP_004417499.1| AAA ATPase [Pusillimonas sp. T7-7]
MMLVELKPLFARLNSYCSAALEGAAGLTLARNHYEISVEHMLRRLLDDVNSDTGRILSHFDVDPLRLGAQ
LDDSLAQLKNGNPGRPVFAGLLTEWVQESWLVSSITLGESRVRSGALLLALIARLSYYGAGTQWVDTLRG
VSREALASHFDDITAGSPEVDLHGGDKPAGAGATAPRGEEAISQFCEDFTAKAAAGKIDPVFGRDAEIRQ
MVDILARRRKNNPICVGEPGVGKTAVVEGLALRIVQDDVPEFLRGTRLLGLDLGLLEAGASVKGEFEKRL
RGVIDEVKASTQSIILFIDEAHMLIGAGGQTGGGDAANLLKPALARGELRTIAATTWSEYKKYFEKDPAL
ARRFQVVKLDEPDVATAVQILRGLKDNYEAAHGVIVRDDAIVAAAELASRYITGRLLPDKAVDLLDTAAA
RVRIGMGIKPAELERLERQLAGLERERAALQRETGYNPGAHSDRLVAIAQESAEVQARHDALHDRWQAQK
TAVDDVIALRKKIDDSPDDAGLQEQLQAARDSLIELQDGDPLIFIETDPDAVARVVSDWTGVPLGKMQRD
AVGGILSLADNIKARIRGQDHAVDKITAAVKAAQSGLRDPRQPMGIFLLVGPSGVGKTETALAVADQLFG
GEQSLVSVNMSEFQEKHTVSRLVGSPPGYVGYGEGGILTEAVRKRPYSVVLLDEVEKAHPDVLNLFYQVF
DKGTLSDGEGRIIDFSNTVVFLTSNLATDEIQNLTSEERPDPDTVSEAIHPLLAKYFKPALLARMTVVPY
YTLPPAYLKGIVDLKLGRLAQRLAAANHIALNFADDVSETIAARCTEVDSGARNIDFILAKSLTPALSDL
ILSAMAEGRVLSTLHISPSKSGDWLIESMQDADAPAMAAEQDDEMKEAAS
 
Nucleotide Sequence: 2673 bp     [Download]
>gi|332283253|ref|NC_015458.1|:c2496845-2494173 Pusillimonas sp. T7-7 chromosome, complete genome
ATGATGCTCGTAGAACTGAAACCCTTGTTCGCACGTCTGAATTCCTATTGTTCAGCCGCACTGGAAGGCG
CCGCAGGCTTGACACTGGCTCGTAATCACTACGAAATCAGTGTCGAGCATATGTTGCGTCGCCTGCTGGA
TGACGTGAACAGCGACACGGGGCGTATTCTTTCCCATTTCGATGTGGACCCTCTGCGCCTGGGGGCGCAA
CTGGATGACAGCCTAGCTCAGCTCAAGAATGGCAATCCGGGGCGACCGGTGTTTGCAGGGCTGTTGACCG
AATGGGTGCAGGAATCGTGGCTTGTATCGTCCATTACCCTGGGCGAAAGCCGGGTGCGCAGTGGCGCCCT
GTTATTGGCGTTGATTGCGCGATTGAGCTATTACGGCGCCGGCACGCAGTGGGTCGATACTTTACGAGGT
GTATCGCGGGAGGCCTTGGCCAGTCATTTCGATGACATTACGGCCGGTTCGCCAGAGGTTGATCTGCATG
GCGGCGACAAGCCGGCAGGCGCAGGAGCCACGGCGCCGCGCGGTGAAGAAGCCATCAGCCAGTTTTGCGA
AGATTTCACGGCCAAGGCTGCAGCGGGAAAAATCGACCCGGTGTTCGGGCGTGACGCCGAGATCCGGCAA
ATGGTCGACATTCTGGCCAGGCGTCGCAAAAACAACCCCATATGCGTGGGCGAGCCGGGGGTGGGCAAGA
CCGCCGTGGTTGAAGGCCTGGCCTTGCGTATTGTGCAGGATGATGTCCCCGAATTCCTGCGTGGTACGCG
CCTGCTGGGTTTGGACCTGGGCCTGCTCGAGGCCGGCGCCAGCGTCAAGGGAGAGTTTGAAAAGCGTCTC
CGCGGCGTGATCGATGAAGTGAAGGCATCGACGCAGTCCATTATCCTGTTCATCGATGAGGCGCATATGT
TGATTGGCGCAGGCGGCCAGACTGGGGGCGGCGATGCCGCCAACCTGCTCAAACCCGCTTTGGCGCGTGG
CGAACTGCGTACCATTGCCGCCACGACCTGGTCGGAATACAAAAAGTACTTCGAGAAAGACCCGGCCTTG
GCTCGGCGCTTCCAGGTGGTCAAGCTTGACGAGCCCGATGTGGCGACGGCGGTTCAGATCTTGCGTGGCC
TGAAAGACAATTACGAAGCCGCCCACGGCGTGATCGTGCGTGACGATGCCATTGTTGCCGCCGCAGAACT
GGCCAGCCGTTATATCACTGGCCGCCTGCTGCCCGACAAGGCGGTCGATTTGCTTGATACGGCAGCGGCT
CGAGTACGTATAGGCATGGGTATCAAGCCAGCGGAACTGGAGCGGCTCGAACGCCAATTGGCCGGCCTGG
AACGCGAGCGCGCCGCCTTGCAACGCGAGACCGGCTACAACCCGGGCGCCCACAGCGATCGCCTGGTAGC
GATTGCCCAGGAGAGCGCCGAGGTGCAGGCTCGGCACGACGCCTTGCATGACCGCTGGCAGGCGCAGAAG
ACGGCTGTTGATGACGTCATTGCCTTACGCAAGAAAATAGACGACTCACCCGACGACGCTGGTTTGCAGG
AGCAACTGCAGGCCGCGCGCGACAGCTTGATCGAACTGCAAGACGGCGATCCCTTGATCTTCATCGAGAC
AGATCCCGACGCGGTCGCTCGCGTGGTATCGGACTGGACCGGCGTACCCTTGGGCAAGATGCAGCGTGAC
GCTGTTGGGGGCATCTTGTCTTTGGCCGACAATATCAAGGCCCGCATACGCGGTCAGGACCACGCCGTGG
ACAAGATCACGGCCGCCGTCAAGGCAGCGCAGTCGGGCTTGCGTGACCCGCGTCAGCCCATGGGCATCTT
TCTGCTGGTTGGCCCATCGGGTGTAGGCAAGACGGAAACCGCCTTGGCCGTTGCCGACCAGCTGTTTGGT
GGCGAGCAGTCGCTGGTATCAGTGAATATGAGTGAATTCCAGGAAAAGCATACCGTCAGCCGCCTGGTGG
GTTCGCCTCCCGGTTATGTGGGCTACGGCGAAGGCGGCATTCTCACCGAGGCCGTGCGCAAAAGGCCTTA
TTCAGTTGTGCTGCTGGACGAAGTGGAAAAGGCCCATCCCGACGTACTCAATCTCTTCTATCAGGTGTTC
GACAAGGGCACATTGTCTGATGGTGAAGGCCGCATCATCGACTTCAGCAATACGGTGGTGTTCCTGACCA
GCAACCTGGCCACAGATGAAATCCAGAACCTGACCAGTGAAGAACGGCCTGATCCCGACACCGTGTCTGA
AGCCATACACCCCTTGCTGGCCAAATACTTCAAGCCGGCACTGCTGGCCCGCATGACGGTCGTGCCTTAT
TACACACTGCCGCCTGCCTACCTGAAGGGCATTGTCGATTTGAAGCTGGGCCGTCTGGCACAGCGTCTGG
CCGCAGCCAACCACATCGCACTGAACTTTGCTGACGACGTGTCGGAAACCATTGCCGCACGGTGCACCGA
AGTGGACAGCGGTGCGCGCAATATTGACTTCATTTTGGCGAAAAGCCTGACGCCCGCACTGTCCGATCTC
ATCCTGTCGGCCATGGCAGAGGGTCGTGTCTTGTCGACCTTGCATATCAGTCCGTCCAAGAGCGGCGATT
GGCTTATTGAATCGATGCAAGATGCCGATGCACCGGCCATGGCGGCTGAACAAGATGATGAAATGAAGGA
AGCCGCATCATGA