SecReT6
Protein ID: 332285589
SecReT6 ID437
T6SS typei1
Gene symbol-
Locus tagPT7_2336
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]2496842..2497882 [-]
Producthypothetical protein
NoteTssG
UniProt IDF4GSE5
KEGG IDput:PT7_2336
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.80E-66, Aligned region: 21..311
Protein Sequence: 346 a.a.     [Download]
>gi|332285589|ref|YP_004417500.1| hypothetical protein PT7_2336 [Pusillimonas sp. T7-7]
MAREDRSLSPALANIEPLLADGPRYAFFQALRLLRLRLGEEAFERSVRVRPALNLSFPESDIDSIVREDD
MLRITANFFGLYGVTSPLPTFYTEDLIDEQLAGTTNSRDFLDILHAALYPMLFKAWEKNRIWLAVVEQQD
GARLNQLMALLGLHRDTGTAASSNLRALLPHAGNFNQYPRSALGLQALVSGLLDGLNVWVEPCVPRTVSI
PFADRTCLGKQACSLGNEALLGSQVAERTGQAYIHAGPMPAVLFERLLPGKDLHARVTQAISHYVQGPIS
CVLGLRVEPAQRVPAALGGGWNSLGLNTWLPEAVAGAADSPGRTEDEVFLPVIDLEKRLQNQRVPS
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|332283253|ref|NC_015458.1|:c2497882-2496842 Pusillimonas sp. T7-7 chromosome, complete genome
ATGGCCCGCGAAGATCGGTCGCTATCGCCTGCTTTAGCGAATATAGAGCCCTTGTTGGCTGACGGGCCTC
GCTACGCCTTCTTCCAGGCGCTGCGCCTGTTGCGGCTGCGTCTGGGCGAAGAAGCCTTTGAGCGATCCGT
GCGTGTGCGTCCGGCGCTGAATCTGTCGTTTCCCGAGAGCGATATAGACAGCATCGTGCGTGAAGACGAC
ATGCTGCGCATCACGGCCAATTTCTTCGGCCTATATGGGGTGACGTCGCCTCTGCCCACTTTCTATACGG
AAGATCTGATCGACGAGCAGCTTGCTGGTACGACGAACTCACGTGACTTTCTGGATATCTTGCATGCCGC
GCTCTATCCCATGCTGTTCAAGGCCTGGGAGAAGAACCGCATCTGGCTTGCGGTGGTGGAGCAGCAGGAC
GGCGCACGGCTGAATCAGCTGATGGCCTTGCTGGGCTTGCATCGCGACACTGGCACCGCAGCTTCAAGCA
ATCTGCGAGCGCTGCTGCCTCATGCGGGCAACTTCAATCAGTATCCGCGCTCAGCGCTGGGCCTGCAGGC
ATTGGTGTCGGGCCTGCTTGATGGCCTGAACGTTTGGGTCGAGCCTTGCGTGCCCCGTACGGTGTCCATT
CCCTTTGCTGATCGCACGTGTCTGGGCAAGCAGGCTTGCAGCCTGGGCAACGAAGCGCTGCTGGGCAGCC
AGGTCGCTGAGCGCACAGGACAAGCCTATATACACGCCGGCCCCATGCCCGCTGTGCTATTCGAACGCCT
CCTGCCTGGCAAAGACTTGCACGCCAGGGTGACGCAGGCTATTTCGCATTATGTGCAAGGCCCCATTTCC
TGCGTGCTGGGCTTGCGTGTAGAGCCAGCCCAGCGCGTACCCGCAGCGCTGGGTGGAGGCTGGAACAGCC
TGGGTCTGAATACCTGGCTGCCCGAAGCTGTCGCTGGCGCTGCAGATTCTCCAGGCCGGACTGAAGATGA
AGTCTTCCTGCCCGTCATCGATCTTGAAAAACGCTTACAAAACCAGAGAGTCCCATCATGA