SecReT6
Protein ID: 332285590
SecReT6 ID437
T6SS typei1
Gene symbol-
Locus tagPT7_2337
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]2497846..2499570 [-]
Producthypothetical protein
NoteTssF
UniProt IDF4GSE6
KEGG IDput:PT7_2337
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.70E-150, Aligned region: 2..573
Protein Sequence: 574 a.a.     [Download]
>gi|332285590|ref|YP_004417501.1| hypothetical protein PT7_2337 [Pusillimonas sp. T7-7]
MLNRYYEQELANLRKLGSEFAQSNPALAPLLGADRASDPDVERLLEGVAFLTGLIRHRLEDDFPEFIQNL
AQLLFPNFLRPLPCMTIMQYEPRMQLEEAVTVDADTEFSSTPVDGQRLVFRSSFPVTIEPVELITPLWEG
GGAQARTLRLRMRYTGIKAGSWKNDSLRFFLGGAHTDATRLYLLLMRHVREVRIYSDDGPIASLPPSCIK
PAGLSPDLGLLPWPGNAHPAWRILHEYFALPEKLLFVDLTGFSRWSGRAAAREFSVQFMFDHVPDWAPAM
GRDSFVMNATPAANLVNADAHPIRVDHRQPDYKIQPVARSSHQVEQIYAVRQVLARSPDGQEREYHSFSA
FRGDDSTSYNLRIRPSALGRGYDHYLSLPYVPQDEPQLLTLSARLTCTHGHLPESLRLGDINAPTDKSPA
RIAFRNILGVTPYSPPTFDSALLWRVLSHLNANHLSLATDNQLQDLLSLYLPSRQASVQRHAAGQRMILS
IEKIRVEPARRMVRGMPVQGSEVTIECQGDHFPGVGSMFLFGTVLDELLAGTAALNTFSVLTLIDTVNGE
TLKWPAKIGRYRLL
 
Nucleotide Sequence: 1725 bp     [Download]
>gi|332283253|ref|NC_015458.1|:c2499570-2497846 Pusillimonas sp. T7-7 chromosome, complete genome
ATGCTGAACCGGTACTACGAACAAGAGCTGGCCAATCTGCGCAAACTGGGTTCGGAATTTGCCCAGAGCA
ATCCTGCGCTGGCGCCCTTGTTGGGCGCCGATCGGGCCAGCGACCCGGATGTGGAACGCTTGCTGGAGGG
CGTCGCCTTCCTGACAGGGCTGATCCGACACCGGCTGGAGGACGATTTCCCCGAGTTCATTCAGAACCTG
GCTCAGCTGCTGTTCCCCAATTTCCTGCGCCCATTGCCATGCATGACCATCATGCAGTATGAGCCCCGGA
TGCAGCTGGAGGAGGCCGTTACGGTTGACGCCGATACAGAGTTTTCAAGCACGCCTGTTGATGGTCAGCG
GCTGGTGTTCCGCTCATCTTTCCCTGTGACGATAGAGCCGGTCGAACTGATTACCCCATTGTGGGAGGGC
GGAGGTGCGCAAGCGCGTACGCTGCGCCTGCGTATGCGTTATACCGGCATCAAGGCGGGCAGCTGGAAGA
ATGACAGCCTGCGTTTTTTTCTGGGCGGCGCCCATACCGATGCAACCCGGCTTTATTTGCTGCTTATGCG
TCATGTGCGTGAAGTGCGTATTTATTCCGACGACGGCCCCATTGCCAGTTTGCCGCCGTCATGTATAAAG
CCAGCAGGGCTAAGCCCTGACCTGGGCTTGCTGCCCTGGCCGGGCAATGCGCATCCGGCATGGCGTATTT
TGCATGAGTACTTTGCTTTGCCCGAAAAGCTGCTGTTCGTCGATTTGACGGGTTTCTCGCGCTGGTCAGG
CCGTGCCGCGGCTCGTGAATTTTCGGTGCAGTTTATGTTTGATCACGTTCCAGACTGGGCGCCGGCAATG
GGGCGCGACAGTTTTGTGATGAACGCCACGCCGGCCGCCAATCTGGTGAATGCCGATGCGCATCCGATAC
GCGTCGATCACCGTCAGCCGGACTACAAAATTCAACCGGTTGCACGCAGCAGCCACCAAGTTGAACAGAT
TTATGCAGTAAGACAGGTTCTTGCGCGCTCGCCCGACGGGCAGGAGCGGGAATATCACTCGTTTTCTGCT
TTCCGGGGCGACGATAGCACCAGCTATAACCTGCGCATACGGCCTTCGGCCCTGGGCCGTGGCTATGACC
ACTATCTTAGCCTGCCCTATGTGCCGCAAGATGAACCTCAATTACTCACGCTTTCGGCACGCCTGACCTG
CACACATGGCCATTTGCCCGAAAGCCTACGCCTGGGTGATATCAATGCGCCCACTGATAAATCGCCGGCG
CGTATTGCCTTTCGAAATATTCTGGGCGTAACGCCCTACAGCCCGCCGACGTTCGATAGTGCATTGCTTT
GGCGCGTGCTGTCGCACTTGAATGCCAACCATCTATCGCTGGCCACCGATAACCAGTTGCAGGATTTGCT
GTCGTTGTACCTGCCGTCGCGGCAGGCCAGTGTGCAGCGCCATGCGGCCGGCCAGCGCATGATCTTGTCG
ATAGAAAAAATTCGTGTGGAGCCAGCACGCCGTATGGTGCGTGGCATGCCGGTGCAAGGCAGCGAGGTCA
CGATCGAGTGCCAGGGCGATCACTTCCCCGGCGTGGGCAGTATGTTCCTGTTTGGCACCGTGCTGGATGA
ACTGCTGGCCGGCACGGCGGCCCTGAATACCTTCAGCGTGCTGACGCTGATAGACACCGTAAACGGAGAA
ACCTTGAAATGGCCCGCGAAGATCGGTCGCTATCGCCTGCTTTAG