SecReT6
Protein ID: 332285591
SecReT6 ID437
T6SS typei1
Gene symbol-
Locus tagPT7_2338
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]2499575..2499940 [-]
Producthypothetical protein
NoteTssE
UniProt IDF4GSE7
KEGG IDput:PT7_2338
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.30E-19, Aligned region: 8..100
Protein Sequence: 121 a.a.     [Download]
>gi|332285591|ref|YP_004417502.1| hypothetical protein PT7_2338 [Pusillimonas sp. T7-7]
MRQHSRSEVLVNSILEHLRRILNTRQGSVPVDPEFGVPDFTNLAGSFSTGTTDQIVQDMSRMIQRYEPRL
RQAQVTFAANRDEVLSLAFSIAGTVNVDDREIPVRLTSQVAANGRVSLRRQ
 
Nucleotide Sequence: 366 bp     [Download]
>gi|332283253|ref|NC_015458.1|:c2499940-2499575 Pusillimonas sp. T7-7 chromosome, complete genome
GTGCGGCAGCATTCCCGCAGCGAAGTCCTCGTCAATTCCATCCTGGAGCACTTGCGCCGCATATTGAACA
CGCGGCAGGGGAGCGTGCCTGTGGATCCCGAGTTTGGCGTACCCGACTTCACCAATCTGGCGGGCTCGTT
CAGCACCGGTACGACAGATCAAATCGTTCAGGACATGAGCCGCATGATTCAGCGCTACGAGCCACGGCTG
CGCCAAGCTCAGGTCACCTTTGCCGCCAATCGCGATGAAGTCTTGTCTCTGGCTTTTTCGATTGCGGGCA
CTGTCAATGTCGACGACCGGGAAATACCGGTACGGCTGACGTCGCAGGTGGCGGCCAATGGCAGGGTATC
TCTTAGGAGGCAATGA