SecReT6
Protein ID: 332285592
SecReT6 ID437
T6SS typei1
Gene symbol-
Locus tagPT7_2339
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]2500042..2500434 [-]
Producthypothetical protein
NoteTssD
UniProt IDF4GSE8
KEGG IDput:PT7_2339
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.40E-31, Aligned region: 2..115
Protein Sequence: 130 a.a.     [Download]
>gi|332285592|ref|YP_004417503.1| hypothetical protein PT7_2339 [Pusillimonas sp. T7-7]
MQAVEHHIELPKNPQSGLPSGKRQHLGITLTKEIDKSSPKLYQALCSGEQMKTVDLEFYRISPKGTEEKY
YTIHLEKAVIVGTRLWVPNCLHPDNRQMGHMEDVGLTYEKIVWTWEPDGIEAEDSWLAPK
 
Nucleotide Sequence: 393 bp     [Download]
>gi|332283253|ref|NC_015458.1|:c2500434-2500042 Pusillimonas sp. T7-7 chromosome, complete genome
GTGCAAGCCGTGGAGCACCATATCGAACTGCCCAAGAATCCGCAGAGCGGTCTGCCCTCGGGCAAGCGCC
AACACTTGGGTATTACTCTGACCAAAGAGATTGATAAGTCGTCACCCAAGCTGTACCAGGCCTTGTGCTC
AGGTGAGCAGATGAAGACGGTCGATCTGGAGTTCTACCGCATCAGCCCCAAGGGCACCGAAGAAAAGTAC
TACACCATTCACCTGGAAAAGGCCGTGATCGTCGGTACGCGCCTGTGGGTACCCAATTGTCTGCATCCGG
ACAACCGTCAGATGGGGCATATGGAAGACGTAGGCCTGACTTACGAGAAAATCGTCTGGACATGGGAGCC
CGACGGCATTGAGGCCGAGGACTCATGGCTGGCCCCCAAATAA