SecReT6
Protein ID: 332285593
SecReT6 ID437
T6SS typei1
Gene symbol-
Locus tagPT7_2340
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]2500628..2502115 [-]
Producthypothetical protein
NoteTssC
UniProt IDF4GSE9
KEGG IDput:PT7_2340
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-186, Aligned region: 68..493
Protein Sequence: 495 a.a.     [Download]
>gi|332285593|ref|YP_004417504.1| hypothetical protein PT7_2340 [Pusillimonas sp. T7-7]
MSENPQAQQDSTQPAVQAEGSLIDQLIESTRIRPDDDAYSMTRQGLEAFVAELLEPSRAKEKVSQGMIDE
MIAGLDRKLCQQVDAIMHEESFQKMESSWRSLKFLVDRTDFRENNRIEILNVSKEDLLADFEDAPDITRS
GLYKAVYTAEFGQFGGEPIGTIIGNYDFGPGGQDIKLLQSIASVSAMAHAPFIAAAGPQFFGLDSYSDLA
NLKDLSAVFEGPQYTKWNAFRESEDARFVGLTMPNFLLRVPYGDETVPTKKFRYNEDVGGGNKDFLWGNA
AFAFASRLSESFAQYRWCANIIGPQGGGTVGDLPVYNYEAMGEAQVKIPTEVLISERREFELAEQGFISL
TMRKNTDNAAFFSANSVQKPKFFGNNPEGKQAELNYKLGTQLPYIFVVSRLAHYIKVIQRENIGTWKERN
DLETELNTWIRQYVADMDNPAAGVRSRRPLRQAEVTVSDVEGDPGWYRVGLKVRPHFKYMGASFTLSLVG
KLDKG
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|332283253|ref|NC_015458.1|:c2502115-2500628 Pusillimonas sp. T7-7 chromosome, complete genome
ATGAGTGAAAACCCCCAAGCACAACAGGACTCGACCCAGCCGGCGGTACAGGCCGAGGGCTCGCTGATAG
ATCAGTTGATCGAATCCACACGCATCAGGCCAGACGACGATGCTTACTCCATGACCCGGCAAGGGCTGGA
AGCCTTTGTTGCCGAGCTGCTGGAACCGAGCCGCGCCAAAGAAAAAGTCAGTCAAGGCATGATCGACGAG
ATGATCGCCGGTCTGGATCGCAAGTTATGCCAGCAAGTCGATGCCATCATGCACGAGGAATCTTTTCAGA
AAATGGAATCGTCCTGGCGTTCGCTGAAATTCCTGGTCGACCGCACCGATTTTCGTGAGAACAACCGCAT
TGAGATCCTGAACGTTTCCAAGGAAGACCTGCTGGCCGATTTTGAAGATGCGCCGGACATCACGCGTTCC
GGGCTGTATAAGGCGGTATATACGGCGGAGTTCGGACAGTTCGGCGGCGAACCCATAGGAACCATTATTG
GGAACTATGATTTTGGCCCAGGTGGTCAGGATATCAAGTTGCTGCAGTCCATCGCCAGTGTCTCGGCGAT
GGCGCACGCTCCTTTTATTGCCGCAGCAGGACCGCAGTTTTTCGGGCTTGACTCTTATTCCGACCTGGCC
AACCTGAAGGACTTGTCGGCCGTGTTTGAAGGGCCTCAATACACGAAGTGGAATGCTTTCCGCGAGTCGG
AAGACGCACGCTTCGTAGGCCTGACCATGCCGAATTTCCTGTTGCGTGTGCCCTATGGCGACGAAACCGT
ACCCACCAAGAAATTCCGCTACAACGAAGACGTAGGCGGCGGCAACAAGGATTTCCTGTGGGGTAACGCA
GCGTTCGCCTTTGCCAGCCGCTTGTCCGAAAGCTTTGCGCAGTATCGCTGGTGCGCCAACATCATTGGCC
CCCAAGGCGGCGGTACGGTGGGTGATTTGCCGGTTTACAACTACGAGGCCATGGGCGAAGCTCAGGTGAA
GATTCCGACCGAGGTGCTGATTTCAGAGCGTCGCGAATTCGAACTGGCCGAGCAGGGCTTTATTTCATTG
ACCATGCGCAAGAACACGGACAATGCCGCATTCTTTTCGGCCAATTCGGTGCAAAAACCCAAGTTCTTCG
GCAACAACCCCGAGGGCAAGCAGGCGGAGCTGAACTACAAGCTGGGTACGCAGTTGCCGTACATCTTTGT
GGTCAGCCGGCTCGCCCATTACATCAAGGTCATCCAGCGCGAAAACATCGGTACATGGAAGGAGCGCAAC
GATCTGGAGACCGAACTCAATACCTGGATACGCCAGTATGTGGCCGACATGGATAATCCGGCCGCCGGCG
TGCGCAGCAGACGACCGCTGCGACAGGCAGAAGTGACTGTTTCGGACGTGGAAGGCGATCCGGGATGGTA
TCGCGTAGGTTTGAAGGTGCGCCCGCACTTTAAATACATGGGTGCGTCTTTCACGCTTTCGCTTGTGGGC
AAGCTTGATAAAGGCTGA