SecReT6
Protein ID: 332285594
SecReT6 ID437
T6SS typei1
Gene symbol-
Locus tagPT7_2341
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]2502121..2502639 [-]
Producthypothetical protein
NoteTssB
UniProt IDF4GSF0
KEGG IDput:PT7_2341
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.10E-55, Aligned region: 5..160
Protein Sequence: 172 a.a.     [Download]
>gi|332285594|ref|YP_004417505.1| hypothetical protein PT7_2341 [Pusillimonas sp. T7-7]
MPKEGSVAPKERVNIVYKPATGDAQEQVELPLKQLVIGDFTQKESDTPVDERKPIQVDKDNFNDVLKGQG
LGLTMAVPNRLSDKPVEDEQIPVTLKFENIRDFEPDSIVEQVPELRQLVELREALKALKGPLGNLPEFRK
KLQALIQDEGARERLLGELGVQDATPDAQDKE
 
Nucleotide Sequence: 519 bp     [Download]
>gi|332283253|ref|NC_015458.1|:c2502639-2502121 Pusillimonas sp. T7-7 chromosome, complete genome
ATGCCCAAAGAAGGATCTGTAGCCCCGAAAGAGCGTGTCAATATTGTTTATAAGCCGGCCACGGGCGACG
CCCAGGAGCAGGTGGAGTTGCCGCTCAAGCAGCTGGTCATTGGCGACTTTACGCAGAAAGAGTCTGATAC
ACCGGTCGACGAGCGCAAGCCCATACAGGTGGACAAGGACAATTTCAATGATGTGCTCAAGGGGCAGGGC
TTGGGCCTGACCATGGCCGTCCCTAATCGTTTGTCGGATAAGCCTGTCGAGGACGAGCAGATTCCAGTCA
CGCTCAAGTTCGAAAATATCCGTGACTTCGAGCCTGATTCCATTGTGGAGCAGGTGCCGGAGCTGCGTCA
GTTGGTCGAGCTGCGTGAAGCGCTCAAGGCCTTGAAGGGGCCGCTGGGCAATCTGCCCGAGTTTCGTAAA
AAACTTCAGGCCCTGATTCAAGATGAGGGCGCACGTGAGCGCCTGTTGGGTGAACTGGGCGTGCAAGATG
CCACCCCTGACGCTCAAGACAAGGAGTAA