SecReT6
Protein ID: 332285595
SecReT6 ID437
T6SS typei1
Gene symbol-
Locus tagPT7_2342
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]2502665..2504248 [-]
Producthypothetical protein
NoteTssA
UniProt IDF4GSF1
KEGG IDput:PT7_2342
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-18, Aligned region: 52..110
Protein Sequence: 527 a.a.     [Download]
>gi|332285595|ref|YP_004417506.1| hypothetical protein PT7_2342 [Pusillimonas sp. T7-7]
MLENTSLRNLGSVPVSASQPAGMNPRDGENFNKLQSQLDRLTDLHAGQAIEWPVVTRLSAAVLQDEGKDL
AVATWLATALFNQHGLSGLVDGVHVLRELVETYWDDMSPPASRMRGRRNQMQWLLDQLTSALDEQAIMQM
SAVPAELHAQMLEDWDALDAAWQAHDEEAPAFYGLSAIMRRLPVEQATDSTEPDQSTAPIQSQSASASAV
PAATSAAMPAPQIASIKLPNGGADAASAVEHGLGSLHPLIAWLMQEQLTAPMLFRLNRICAWTALEQLPP
AQGRSTRLPPPPGQLLDTFNQVIKGGEPEAIIRYAEARLASLPYWLDLNRASHMALTQLKASRAAEALVL
ETAHFMARLPGLSELTFSDGQAFADPATQAWLEALQASGSPDGTNSERDVVAALAHEAESQAVAGKLEEA
LSQLQAAVRGAESRRASFRLRLAQCRLIHRFDVKTDMRALIAPLIEELDIHHLSTWEPDLARQALELAAG
IELRRRADGAEPVVPMLGRLSRVDVQAAWQLSQSTAD
 
Nucleotide Sequence: 1584 bp     [Download]
>gi|332283253|ref|NC_015458.1|:c2504248-2502665 Pusillimonas sp. T7-7 chromosome, complete genome
GTGTTAGAGAACACCTCCTTGCGTAATCTGGGTTCAGTACCCGTCAGTGCTTCACAGCCTGCCGGCATGA
ATCCACGCGATGGGGAAAACTTCAACAAGTTGCAGTCCCAATTGGACAGGCTGACGGACCTGCATGCCGG
ACAGGCCATTGAATGGCCTGTTGTGACCAGGCTGAGCGCAGCCGTGCTGCAAGACGAGGGCAAGGACCTG
GCCGTTGCCACTTGGTTGGCGACTGCACTGTTTAATCAACATGGCTTGTCCGGGTTGGTTGATGGTGTTC
ATGTATTGCGTGAGTTGGTCGAGACTTACTGGGACGATATGTCGCCCCCGGCGTCCCGTATGCGTGGCCG
GCGCAACCAGATGCAATGGCTACTGGATCAGTTGACATCGGCGCTGGATGAGCAGGCCATCATGCAGATG
TCGGCAGTGCCTGCTGAACTGCATGCGCAGATGCTGGAAGACTGGGACGCGCTGGACGCGGCTTGGCAAG
CCCATGATGAAGAGGCTCCGGCATTCTATGGCCTGAGCGCCATCATGCGCCGTTTGCCGGTCGAGCAGGC
GACCGACTCGACTGAGCCTGACCAGTCGACTGCACCAATCCAATCGCAATCCGCATCGGCAAGCGCAGTC
CCCGCAGCGACCAGTGCCGCCATGCCGGCGCCGCAGATAGCCAGTATCAAGTTGCCCAATGGCGGCGCTG
ATGCCGCGAGCGCTGTGGAGCATGGGCTTGGCAGCCTGCATCCACTGATCGCATGGCTGATGCAGGAACA
ACTCACTGCACCCATGTTGTTTCGTCTGAATCGTATTTGTGCCTGGACCGCACTCGAGCAACTGCCGCCA
GCGCAGGGGCGCAGTACGCGTCTGCCGCCGCCACCAGGGCAATTGCTTGATACCTTCAATCAAGTGATTA
AGGGGGGCGAGCCAGAAGCCATCATTCGCTACGCCGAAGCGCGCCTGGCTTCGCTGCCGTATTGGCTGGA
TTTGAACCGTGCCAGCCATATGGCATTGACACAGCTGAAAGCCAGCCGGGCTGCCGAGGCCCTTGTCCTG
GAGACGGCTCACTTCATGGCCCGTTTGCCCGGACTCTCGGAGTTGACGTTCAGCGACGGCCAGGCTTTTG
CAGACCCGGCCACCCAGGCCTGGCTCGAAGCACTGCAAGCATCAGGCAGCCCGGATGGCACAAACTCAGA
GCGTGACGTTGTCGCTGCCTTGGCGCACGAGGCGGAAAGCCAGGCCGTGGCGGGAAAGCTGGAAGAGGCG
CTGTCGCAGTTGCAGGCAGCGGTGCGTGGCGCTGAAAGCCGTCGGGCAAGCTTTCGACTGCGCCTGGCCC
AGTGCCGTCTGATACACCGGTTTGACGTGAAGACTGATATGCGGGCGCTGATCGCCCCACTGATAGAAGA
ACTCGACATCCATCACCTATCCACCTGGGAGCCGGACTTGGCCCGGCAGGCATTGGAGCTGGCGGCGGGT
ATCGAATTGCGGCGCCGTGCTGATGGCGCCGAACCCGTAGTGCCCATGCTGGGACGTCTGTCCCGTGTCG
ATGTTCAGGCTGCGTGGCAGCTGTCGCAATCAACCGCTGACTGA