SecReT6
Protein ID: 332715416
SecReT6 ID438
T6SS typei5
Gene symbol-
Locus tagAGROH133_09374
StrainAgrobacterium sp. H13-3
Repliconchromosome linear [GenBank: NC_015508] [Browse all T6SS(s) in this replicon]
Location [Strand]39434..42103 [-]
ProductATP-dependent Clp protease, ATP-binding subunit
NoteTssH
UniProt IDF0LDA5
KEGG IDagr:AGROH133_09374
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.40E-38, Aligned region: 222..299
AAA_2 [PF07724], Evalue: 1.40E-38, Aligned region: 591..755
AAA [PF00004], Evalue: 1.70E-20, Aligned region: 223..334
AAA [PF00004], Evalue: 1.70E-20, Aligned region: 596..722
AAA_5 [PF07728], Evalue: 9.30E-15, Aligned region: 223..243
AAA_5 [PF07728], Evalue: 9.30E-15, Aligned region: 437..458
AAA_5 [PF07728], Evalue: 9.30E-15, Aligned region: 595..721
AAA_16 [PF13191], Evalue: 7.00E-14, Aligned region: 145..199
AAA_16 [PF13191], Evalue: 7.00E-14, Aligned region: 200..244
AAA_16 [PF13191], Evalue: 7.00E-14, Aligned region: 268..301
AAA_16 [PF13191], Evalue: 7.00E-14, Aligned region: 348..452
AAA_16 [PF13191], Evalue: 7.00E-14, Aligned region: 563..616
AAA_16 [PF13191], Evalue: 7.00E-14, Aligned region: 660..688
ClpB_D2-small [PF10431], Evalue: 1.90E-10, Aligned region: 763..837
Clp_N [PF02861], Evalue: 6.90E-08, Aligned region: 24..73
Sigma54_activat [PF00158], Evalue: 7.50E-08, Aligned region: 201..241
Sigma54_activat [PF00158], Evalue: 7.50E-08, Aligned region: 585..711
AAA_22 [PF13401], Evalue: 1.20E-07, Aligned region: 223..303
AAA_22 [PF13401], Evalue: 1.20E-07, Aligned region: 356..389
AAA_22 [PF13401], Evalue: 1.20E-07, Aligned region: 595..618
AAA_22 [PF13401], Evalue: 1.20E-07, Aligned region: 657..676
Zeta_toxin [PF06414], Evalue: 2.00E-06, Aligned region: 217..247
Zeta_toxin [PF06414], Evalue: 2.00E-06, Aligned region: 304..389
Zeta_toxin [PF06414], Evalue: 2.00E-06, Aligned region: 588..635
AAA_25 [PF13481], Evalue: 2.60E-06, Aligned region: 221..281
AAA_25 [PF13481], Evalue: 2.60E-06, Aligned region: 419..453
AAA_25 [PF13481], Evalue: 2.60E-06, Aligned region: 591..620
AAA_17 [PF13207], Evalue: 4.50E-05, Aligned region: 223..272
AAA_17 [PF13207], Evalue: 4.50E-05, Aligned region: 595..630
NACHT [PF05729], Evalue: 7.10E-05, Aligned region: 223..251
NACHT [PF05729], Evalue: 7.10E-05, Aligned region: 595..634
AAA_18 [PF13238], Evalue: 9.10E-05, Aligned region: 223..245
AAA_18 [PF13238], Evalue: 9.10E-05, Aligned region: 596..625
Arch_ATPase [PF01637], Evalue: 0.00011, Aligned region: 202..238
Arch_ATPase [PF01637], Evalue: 0.00011, Aligned region: 276..375
Arch_ATPase [PF01637], Evalue: 0.00011, Aligned region: 590..607
IstB_IS21 [PF01695], Evalue: 0.00012, Aligned region: 217..245
IstB_IS21 [PF01695], Evalue: 0.00012, Aligned region: 595..613
AAA_19 [PF13245], Evalue: 0.00051, Aligned region: 141..158
AAA_19 [PF13245], Evalue: 0.00051, Aligned region: 220..244
AAA_19 [PF13245], Evalue: 0.00051, Aligned region: 594..617
PhoH [PF02562], Evalue: 0.00074, Aligned region: 208..245
PhoH [PF02562], Evalue: 0.00074, Aligned region: 594..613
DUF2075 [PF09848], Evalue: 0.0019, Aligned region: 225..325
DUF2075 [PF09848], Evalue: 0.0019, Aligned region: 593..629
ResIII [PF04851], Evalue: 0.0037, Aligned region: 195..245
ResIII [PF04851], Evalue: 0.0037, Aligned region: 290..304
ResIII [PF04851], Evalue: 0.0037, Aligned region: 567..616
SRP54 [PF00448], Evalue: 0.0061, Aligned region: 223..242
SRP54 [PF00448], Evalue: 0.0061, Aligned region: 593..617
Protein Sequence: 889 a.a.     [Download]
>gi|332715416|ref|YP_004442882.1| ATP-dependent Clp protease, ATP-binding subunit [Agrobacterium sp. H13-3]
MSHIDLNRLVGALEPVLRVTLEAAASVAVRMGHRYVDIPHWLLAVVDSGIYAKTFEELKIPLPVLQAEIS
RSLEESIIGDGEALSLSQNILTAAREAWILASLEAGRDRVTLCDLLLAMDEETSLRSFVRSAFPSLKAMD
RTALERLRNSTENGAGVDVPSALAGSGQAGTGQSAGQNDFLRLYTQDMTADARNGKVDPVIGRDDELRQL
VDILTRRRQNNPILVGEAGVGKTAVAEALALEIASGNVPEKLRNVRLLNLDISLLQAGAGVKGEFERRLH
GVIDAVKRSTEPVILFIDEAHGLVGAGGAAGQGDAANILKPALARGEVRTVAATTWSEYKKYFEKDAALT
RRFQPVHVREPDETTAIRMLRGVADSFVSHHNVVVRDEAVVAAVQLSARYMPARQLPDKAVSLLDTAAAA
VSLARQTEPERLRAMESERRLLTDELNWLLREPQDGEIDSRIQSIRGEVEKLESGIDDLRSRYDAEMAEL
SEEQPVEGDVSNVSPLRPAVEAKPANAERLVPTVVDREAIAAVVSRWTGIPLGKLLADQIESARTLDARM
RQRVVGQDAAIARIADAMRTARAGLSDPRRPPAVFFLVGMSGTGKTETALSLADMLYGGNSHLTTINMSE
FKEEHKVSLLLGSPPGYVGFGEGGVLTEAVRRRPFGVLLLDEIDKAHPGVQDIFYQVFDKGVLRDGEGRD
VDFKNTTIFMTANTGSELLSALSADPDTMPEGEALEALLMPELTKQFKPAFLGRTIILPFMPLGTEALAR
IVDMQIGKIRERVLATYGTGLTLSNVARDALVARAGASEIGARAIEIMIGKDLLPPLSSFFLEKVIAGER
VGNIVVDFGENGFGIRAEEAGEADEFAVTEEVGVDKVAASDGATRRMRH
 
Nucleotide Sequence: 2670 bp     [Download]
>gi|332715374|ref|NC_015508.1|:c42103-39434 Agrobacterium sp. H13-3 chromosome linear, complete sequence
ATGTCGCATATCGATCTCAACCGCCTTGTTGGAGCGCTTGAGCCAGTCCTGCGTGTTACCCTTGAAGCTG
CGGCTTCTGTTGCGGTGCGCATGGGGCACAGATACGTGGATATCCCGCATTGGCTGCTTGCGGTTGTGGA
CTCCGGCATCTATGCGAAAACATTCGAGGAATTAAAAATTCCACTTCCGGTATTGCAGGCTGAAATCAGC
CGCAGTCTGGAGGAGTCCATCATCGGCGACGGAGAGGCATTGTCGCTCTCCCAGAACATCCTCACGGCAG
CCCGGGAGGCATGGATTCTCGCATCGCTGGAGGCTGGCCGCGACCGTGTTACGCTTTGCGATCTTCTGTT
GGCGATGGATGAGGAAACCTCACTTCGCTCTTTCGTCCGCTCGGCATTTCCTTCTCTCAAGGCGATGGAT
CGCACCGCGCTTGAGCGTCTTCGCAACTCGACTGAAAATGGCGCAGGCGTGGATGTTCCTTCCGCGCTGG
CAGGCTCAGGGCAGGCAGGGACAGGACAGTCTGCAGGCCAGAATGATTTCTTGCGCCTTTACACCCAGGA
CATGACCGCAGATGCCCGCAATGGCAAGGTTGATCCTGTTATCGGCCGCGATGATGAGTTACGCCAGCTC
GTTGATATTCTAACGCGCCGCCGACAGAACAATCCCATCCTGGTAGGTGAGGCGGGGGTTGGCAAAACGG
CGGTTGCCGAGGCGCTGGCGCTGGAAATCGCGTCTGGCAACGTTCCGGAAAAGTTGCGCAATGTCCGCCT
GCTGAACCTCGATATTTCGCTACTTCAGGCCGGTGCCGGCGTTAAGGGTGAGTTTGAGCGCCGCCTTCAT
GGCGTAATCGATGCGGTCAAACGTTCTACCGAACCGGTCATCCTGTTTATCGATGAGGCCCACGGTCTCG
TTGGTGCGGGTGGTGCGGCCGGGCAGGGCGATGCGGCCAATATTCTCAAGCCCGCTCTGGCGCGGGGTGA
AGTGCGCACCGTCGCGGCGACGACCTGGAGCGAATACAAGAAGTATTTCGAAAAGGATGCGGCGCTGACC
CGTCGTTTCCAGCCTGTACATGTGCGCGAGCCGGATGAGACGACCGCCATACGTATGTTGCGCGGTGTCG
CTGACAGCTTCGTCAGCCATCACAACGTTGTCGTTCGTGACGAGGCGGTCGTGGCCGCGGTGCAATTATC
CGCACGCTACATGCCCGCGCGGCAGTTGCCGGACAAGGCCGTCAGCCTTCTCGATACGGCCGCGGCTGCC
GTCTCACTGGCACGGCAGACCGAGCCGGAGCGGCTGCGCGCTATGGAAAGCGAGCGGCGCCTTCTCACCG
ATGAGTTGAACTGGCTTCTGCGTGAACCGCAGGATGGCGAGATTGACAGCCGTATCCAGTCGATACGGGG
CGAAGTCGAAAAGCTTGAGAGTGGGATCGATGATCTGCGCAGCCGTTACGACGCGGAGATGGCTGAGCTA
AGCGAAGAGCAGCCGGTTGAAGGCGATGTTTCCAATGTCTCTCCCCTGCGGCCTGCGGTTGAGGCAAAAC
CGGCAAATGCCGAGAGACTTGTCCCGACGGTCGTTGATCGTGAGGCGATCGCCGCCGTCGTTTCGCGATG
GACCGGAATTCCACTTGGCAAACTTCTGGCGGACCAGATCGAAAGTGCCCGGACACTCGATGCGCGTATG
CGGCAGCGGGTGGTGGGGCAGGATGCTGCAATTGCACGGATTGCCGATGCCATGCGCACTGCGCGGGCCG
GATTATCCGATCCGCGCCGCCCGCCGGCCGTTTTTTTCCTTGTTGGCATGTCCGGAACAGGAAAGACCGA
AACCGCGCTGTCGCTCGCCGATATGCTCTACGGCGGCAACAGCCATTTGACGACGATCAACATGTCGGAG
TTCAAGGAAGAGCATAAGGTTTCGCTGCTTCTCGGTTCGCCGCCCGGCTATGTCGGTTTCGGCGAAGGCG
GCGTGTTGACGGAAGCGGTGCGCCGTCGGCCGTTCGGCGTTCTGCTCTTGGATGAGATCGACAAGGCTCA
CCCCGGCGTCCAGGACATTTTCTATCAGGTGTTTGACAAGGGCGTGTTGCGTGATGGCGAAGGCCGCGAC
GTGGATTTCAAGAACACCACTATCTTCATGACGGCCAATACAGGCTCGGAGTTGCTCTCGGCGCTGTCGG
CCGATCCCGACACGATGCCGGAAGGCGAAGCGCTGGAAGCGCTTCTGATGCCGGAGCTTACCAAACAGTT
CAAGCCCGCGTTCCTCGGGCGCACGATCATTCTTCCCTTCATGCCGCTTGGTACGGAGGCGCTTGCAAGG
ATCGTGGATATGCAGATTGGCAAGATCAGGGAACGTGTGCTCGCAACATATGGCACCGGCCTGACCCTGT
CCAATGTGGCGCGAGATGCCTTGGTGGCGCGCGCCGGTGCAAGTGAGATTGGCGCACGCGCCATTGAAAT
CATGATCGGCAAGGACCTCCTGCCGCCTCTTTCCAGCTTTTTCCTCGAAAAGGTAATCGCGGGAGAGCGT
GTCGGGAACATTGTTGTCGATTTTGGTGAAAACGGGTTCGGCATTCGTGCCGAAGAGGCTGGGGAAGCAG
ATGAATTCGCCGTAACCGAAGAGGTTGGGGTGGATAAAGTTGCCGCGTCGGATGGGGCTACCCGACGCAT
GCGGCATTAA