SecReT6
Protein ID: 332715417
SecReT6 ID438
T6SS typei5
Gene symbol-
Locus tagAGROH133_09375
StrainAgrobacterium sp. H13-3
Repliconchromosome linear [GenBank: NC_015508] [Browse all T6SS(s) in this replicon]
Location [Strand]42324..43379 [+]
Producthypothetical protein
NoteTssA
UniProt IDF0LDA6
KEGG IDagr:AGROH133_09375
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.20E-15, Aligned region: 59..114
Protein Sequence: 351 a.a.     [Download]
>gi|332715417|ref|YP_004442883.1| hypothetical protein AGROH133_09375 [Agrobacterium sp. H13-3]
MNAPNVKTDVEFLNDCGENIRVNARTREIYYRIKDERNQARTEERAASPQDNLKISSSWDNVSNLGLQII
YSESKDVEILAWLAEASLRLRGFHGLREIYDLGKELFYNHWDSLRSISDDNDEEKFAPLAGLNGVGSEGT
LVQPLRLASLIPGGKFGEHSLWDFQLAQRPNESKRREELYRLASETGVAAMSSQLAEVTACLSSFDAIMA
ILAERCGQSAPPSSNIRNTLVEAASAIRSLGGRDQEPASVEQEPVGISGSDESGPAAARPAVTAPEGILS
RDEAFETLLSVARYFRRTEPHSPISLAIETLVRRGRMDFSELLAELLPEAQVRNAVLTAAGIKPSGESNG
K
 
Nucleotide Sequence: 1056 bp     [Download]
>gi|332715374|ref|NC_015508.1|:42324-43379 Agrobacterium sp. H13-3 chromosome linear, complete sequence
TTGAACGCGCCGAACGTTAAAACAGATGTAGAATTTCTGAATGACTGCGGAGAAAATATCCGGGTCAACG
CAAGAACGCGTGAAATATACTATAGAATTAAGGATGAAAGAAACCAAGCTCGTACAGAAGAGCGCGCCGC
TTCTCCGCAGGATAACCTGAAAATATCCAGTAGCTGGGATAATGTCAGCAATCTTGGATTGCAGATTATA
TATTCCGAAAGCAAGGATGTTGAAATATTGGCGTGGCTTGCGGAAGCATCGCTGCGCCTGCGCGGCTTTC
ATGGTCTGCGCGAAATCTACGACCTCGGCAAAGAGCTGTTTTACAACCACTGGGACTCGCTGCGGTCAAT
CAGCGACGATAATGACGAAGAAAAATTTGCACCTTTAGCGGGATTGAACGGTGTCGGCAGCGAAGGAACG
CTTGTTCAGCCTTTGCGCCTCGCCTCATTGATCCCAGGCGGCAAATTTGGCGAACACAGCCTATGGGACT
TTCAACTCGCGCAGCGCCCAAATGAGAGCAAACGTCGCGAAGAGCTATATCGGCTTGCGTCTGAAACTGG
CGTTGCCGCCATGTCATCCCAGTTGGCAGAGGTGACTGCGTGCCTCTCCTCGTTTGATGCCATCATGGCC
ATCCTTGCCGAGCGCTGCGGGCAATCCGCACCACCGAGTTCCAATATCCGCAACACGCTGGTCGAAGCAG
CGTCTGCAATTCGCTCGCTCGGCGGGCGTGACCAGGAGCCGGCATCCGTCGAACAGGAACCTGTGGGCAT
CAGCGGTTCAGACGAGAGCGGGCCGGCGGCCGCGCGGCCCGCCGTGACCGCACCGGAAGGCATATTATCG
CGCGACGAAGCATTTGAAACTCTTCTCTCGGTTGCGCGTTACTTCCGCCGTACCGAGCCGCATTCACCGA
TCTCCCTTGCCATAGAGACACTGGTGCGCAGGGGACGCATGGATTTTTCGGAACTGCTGGCCGAGCTTTT
GCCGGAAGCCCAGGTTCGCAACGCAGTCTTAACCGCCGCCGGCATCAAGCCAAGCGGAGAGAGCAACGGA
AAATAG