SecReT6
Protein ID: 332715418
SecReT6 ID438
T6SS typei5
Gene symbol-
Locus tagAGROH133_09376
StrainAgrobacterium sp. H13-3
Repliconchromosome linear [GenBank: NC_015508] [Browse all T6SS(s) in this replicon]
Location [Strand]43445..43954 [+]
Producthypothetical protein
NoteTssB
UniProt IDF0LDA7
KEGG IDagr:AGROH133_09376
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.00E-60, Aligned region: 8..163
Protein Sequence: 169 a.a.     [Download]
>gi|332715418|ref|YP_004442884.1| hypothetical protein AGROH133_09376 [Agrobacterium sp. H13-3]
MASVHEKLERVRKPRVHIKYEVETEGAMVVKELPFVVGVLGDFSGNPTQPLKPFGERKFVQIDRDNFDEV
MRRMTPGLNISVANTLQKDGTDMQVNLKFESMDDFEPGAVVQQVPALKALLDARNELRDLLSKADRSEDL
ERMLEDILQNKTDLATLVSELKEKNGANE
 
Nucleotide Sequence: 510 bp     [Download]
>gi|332715374|ref|NC_015508.1|:43445-43954 Agrobacterium sp. H13-3 chromosome linear, complete sequence
ATGGCAAGTGTACATGAGAAGCTGGAGCGTGTTCGCAAACCACGCGTTCACATCAAATACGAAGTCGAAA
CCGAAGGCGCGATGGTAGTCAAGGAACTGCCTTTCGTGGTCGGTGTGCTCGGTGATTTCTCCGGCAATCC
CACCCAGCCGCTCAAGCCGTTCGGGGAGCGTAAATTCGTTCAGATCGACCGCGACAATTTCGACGAAGTC
ATGCGGCGCATGACGCCCGGCCTCAATATTTCCGTTGCCAATACGCTGCAAAAGGATGGCACGGACATGC
AGGTCAACCTGAAGTTCGAAAGTATGGATGATTTCGAACCCGGCGCTGTCGTGCAGCAGGTTCCGGCGCT
CAAGGCGCTTTTGGATGCCCGCAACGAACTGCGCGACCTTCTTTCCAAGGCCGACCGTTCGGAAGATCTG
GAGCGGATGCTGGAGGATATTCTGCAAAACAAGACCGACCTCGCAACGCTGGTTTCCGAACTCAAGGAAA
AGAACGGCGCGAACGAATAA