SecReT6
Protein ID: 332715419
SecReT6 ID438
T6SS typei5
Gene symbol-
Locus tagAGROH133_09377
StrainAgrobacterium sp. H13-3
Repliconchromosome linear [GenBank: NC_015508] [Browse all T6SS(s) in this replicon]
Location [Strand]44051..45532 [+]
Producthypothetical protein
NoteTssC
UniProt IDF0LDA8
KEGG IDagr:AGROH133_09377
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.20E-191, Aligned region: 64..490
Protein Sequence: 493 a.a.     [Download]
>gi|332715419|ref|YP_004442885.1| hypothetical protein AGROH133_09377 [Agrobacterium sp. H13-3]
MSAESLLKNEAQATTAEDQGLLSKVVAATRQTEPDRAQNLLRTLTDQALKGTVKYDRNLTVTLNHAIAEL
DRTISEQLAAIMQAPEFAKLEGTWRGLNYLVKNSETSVNLKIRVMNAGKRELARDLEKAVEFDQSRLFKA
IYEDEFGTPGGEPLGAIIGDYEFDNSFDDVQLLQGVSSIAAAAFAPFISAASPHMFGFEDYRDLARPRDL
EKIFDTVEYAKWRSFRESDDSRFVTLALPRVLARMPYGPKTNPIDDFAYDETKGAVNGDLEHDEYCWMNA
AYVMGTKLTDAFAKSGWCTAIRGAENGGKVENLPMHVFSSDDGDLDLKCPTEVGITDRRDAELGKLGFLP
LCHYKNTDYAVFFGAQTAHKPKLYDKPEATANAAVSARLPYIMATSRFAHYLKVMGRDKIGSFMEASDCE
VWLNRWIANYVNANDEAGEESRAKYPLRDAKVTVQEVPGKPGAYNAVAWMRPWLQMEELTTSLRMVARIP
SKN
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|332715374|ref|NC_015508.1|:44051-45532 Agrobacterium sp. H13-3 chromosome linear, complete sequence
ATGAGCGCTGAGAGCCTGCTGAAAAATGAAGCACAGGCAACGACCGCCGAAGATCAGGGACTGCTGTCCA
AGGTGGTTGCCGCTACCCGTCAAACCGAACCGGACCGCGCGCAGAACCTCCTGCGTACGCTGACCGATCA
AGCACTGAAGGGGACGGTAAAATATGATCGCAACCTCACCGTCACCCTTAACCACGCGATCGCGGAGCTG
GACCGCACGATTTCCGAACAGCTCGCCGCTATCATGCAGGCGCCCGAATTCGCCAAGCTTGAGGGCACCT
GGCGCGGGTTGAACTATCTCGTCAAGAACTCCGAAACGAGCGTCAACCTCAAGATCCGCGTCATGAATGC
CGGCAAGCGTGAACTGGCGCGCGATCTCGAAAAAGCCGTCGAATTCGATCAGTCCCGCCTCTTCAAGGCG
ATCTATGAAGACGAATTCGGCACCCCCGGCGGCGAACCGCTCGGCGCCATTATCGGCGATTACGAATTCG
ACAATTCCTTCGATGACGTCCAGCTGCTGCAAGGCGTCTCATCGATCGCGGCGGCAGCCTTCGCGCCATT
CATCTCTGCTGCCAGCCCGCACATGTTCGGTTTCGAGGACTATCGCGATCTCGCCCGTCCGCGCGATCTG
GAAAAGATTTTCGACACGGTCGAATATGCCAAGTGGCGCAGCTTCCGCGAAAGTGACGATTCCCGTTTCG
TCACGCTCGCTCTTCCGCGTGTGCTGGCGCGTATGCCCTACGGCCCGAAAACCAACCCGATCGATGACTT
CGCCTATGACGAAACCAAGGGTGCGGTGAATGGTGACCTTGAGCATGACGAATATTGCTGGATGAACGCT
GCATACGTGATGGGCACCAAGCTGACCGATGCCTTCGCAAAAAGCGGTTGGTGTACGGCTATCCGAGGGG
CTGAAAACGGCGGCAAGGTGGAAAACCTGCCCATGCATGTCTTCTCCAGCGATGACGGCGACCTGGATCT
GAAATGCCCGACCGAAGTCGGCATTACCGACCGCCGCGACGCCGAACTCGGCAAACTCGGCTTTCTGCCG
CTGTGCCACTATAAGAACACGGACTATGCGGTGTTCTTCGGCGCCCAGACCGCGCACAAGCCGAAGCTCT
ACGACAAGCCGGAAGCAACGGCCAACGCCGCCGTTTCGGCACGCCTGCCCTACATCATGGCCACGTCGCG
TTTCGCGCATTATCTCAAGGTCATGGGGCGCGACAAGATCGGCTCCTTCATGGAAGCGTCCGATTGCGAA
GTCTGGCTCAATCGCTGGATCGCCAACTACGTCAACGCCAATGACGAGGCGGGTGAGGAAAGCCGCGCCA
AATATCCGCTGCGCGATGCCAAGGTGACCGTGCAGGAAGTGCCCGGCAAACCCGGCGCCTACAATGCGGT
CGCATGGATGCGGCCCTGGTTGCAGATGGAAGAACTGACGACCTCGCTGCGCATGGTCGCCCGTATTCCG
TCGAAGAACTGA