SecReT6
Protein ID: 332715420
SecReT6 ID438
T6SS typei5
Gene symbol-
Locus tagAGROH133_09378
StrainAgrobacterium sp. H13-3
Repliconchromosome linear [GenBank: NC_015508] [Browse all T6SS(s) in this replicon]
Location [Strand]45588..46982 [+]
Producthypothetical protein
NoteTssC
UniProt IDF0LDA9
KEGG IDagr:AGROH133_09378
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.10E-151, Aligned region: 14..444
Protein Sequence: 464 a.a.     [Download]
>gi|332715420|ref|YP_004442886.1| hypothetical protein AGROH133_09378 [Agrobacterium sp. H13-3]
MAHQSFTDARIFADQLIALIDDALTGQVNAILHHPDFQAMEARWRGLAMVVREAGRSTDVKVKLLNASWR
DLARNTERATDFDQSHLFEAVYNREFGMPGGEPVGLLIGDYAFSPDDLDGADSITTLSQIGMVAAAAFCP
FVAAASPSTVGLQDFSELSRVHDFSWLKQEKSRLRWNALRARDDSRFVGLVAPRVLLRSPYRPYARRRDD
GFPFREHVAESGETLLWGNAAFAFATVVVRNFVDSGWFADLRGVTQDAVDGGMLSARQLPPLDLGIESNG
LSAQPPVEVQLTTGQEQQFSDLGIVPVSTTYLSGMAIFNANQSLHAPGHYSTEAARQNARLAAMLQYVLC
ASRFSHYLKVIMRDDIGQLSDATTIERKLESWLSSYTLGNDDAEAALRIRYPLRSAGINVFEVPGKPGTF
SCTVRLQPHFQLDDVSTSFHLIAETMMPATAASRPSAEPQRISA
 
Nucleotide Sequence: 1395 bp     [Download]
>gi|332715374|ref|NC_015508.1|:45588-46982 Agrobacterium sp. H13-3 chromosome linear, complete sequence
ATGGCGCATCAGTCCTTCACGGACGCCCGTATTTTCGCCGACCAGCTCATCGCCCTCATCGACGATGCGC
TGACCGGCCAGGTGAACGCTATTCTCCACCATCCTGATTTTCAGGCGATGGAGGCGAGATGGCGCGGGCT
TGCCATGGTCGTGCGCGAGGCGGGCCGGAGCACCGACGTGAAGGTGAAACTGCTGAACGCCAGCTGGCGC
GACCTTGCCCGCAACACGGAACGCGCCACCGACTTCGACCAGAGCCATCTTTTCGAGGCCGTCTATAACC
GCGAATTTGGCATGCCGGGCGGCGAACCGGTCGGCCTTCTGATCGGTGACTACGCCTTTTCCCCTGATGA
TCTTGATGGTGCCGATTCCATCACAACGCTGTCACAGATCGGCATGGTGGCTGCGGCCGCCTTCTGCCCT
TTCGTAGCGGCGGCTTCGCCCTCCACCGTTGGGCTGCAGGACTTTTCGGAGCTCAGCCGGGTCCATGACT
TTTCCTGGCTGAAACAGGAGAAATCGCGGCTGCGGTGGAATGCGCTTCGCGCACGCGACGATTCACGCTT
CGTAGGCCTTGTCGCACCGCGCGTTTTGCTACGTTCTCCCTACAGGCCCTATGCGCGCCGGCGGGATGAC
GGATTTCCATTCCGCGAGCATGTGGCGGAAAGCGGCGAGACCCTGCTGTGGGGCAACGCCGCCTTTGCCT
TCGCAACGGTTGTGGTGCGCAATTTCGTCGATTCCGGCTGGTTTGCGGATCTGCGCGGTGTGACACAGGA
CGCCGTGGATGGCGGCATGCTCTCTGCCCGACAATTGCCACCGCTTGATCTCGGCATCGAGAGTAACGGC
CTGTCCGCCCAGCCGCCCGTGGAAGTGCAACTGACGACTGGGCAGGAACAGCAATTTTCCGATCTGGGCA
TCGTACCCGTCTCCACAACCTATCTTTCCGGCATGGCGATCTTCAACGCCAACCAATCCCTGCATGCACC
AGGCCATTACTCCACCGAAGCGGCGAGGCAGAACGCCCGCCTCGCTGCCATGCTGCAATATGTGCTGTGT
GCCTCCCGGTTCTCGCATTACCTCAAGGTCATCATGCGCGATGACATCGGCCAGCTCAGCGATGCCACGA
CCATCGAGCGTAAACTGGAAAGCTGGCTTTCCTCCTATACGCTCGGCAACGACGATGCGGAGGCGGCGTT
GCGCATCCGCTATCCGCTGCGCTCTGCAGGGATCAATGTCTTCGAGGTTCCCGGCAAGCCCGGAACATTC
TCATGCACCGTGCGCCTTCAGCCGCATTTCCAGCTCGATGACGTCTCCACGAGCTTCCACCTCATTGCCG
AAACCATGATGCCGGCCACCGCCGCATCCCGGCCTTCGGCCGAGCCGCAAAGGATATCCGCATGA