SecReT6
Protein ID: 332715421
SecReT6 ID438
T6SS typei5
Gene symbol-
Locus tagAGROH133_09379
StrainAgrobacterium sp. H13-3
Repliconchromosome linear [GenBank: NC_015508] [Browse all T6SS(s) in this replicon]
Location [Strand]46979..47800 [+]
Producthypothetical protein
NoteTagJ
UniProt IDF0LDB0
KEGG IDagr:AGROH133_09379
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.50E-32, Aligned region: 142..261
TPR_14 [PF13428], Evalue: 1.00E-05, Aligned region: 10..42
TPR_14 [PF13428], Evalue: 1.00E-05, Aligned region: 40..68
TPR_14 [PF13428], Evalue: 1.00E-05, Aligned region: 105..132
TPR_19 [PF14559], Evalue: 0.00025, Aligned region: 10..66
TPR_19 [PF14559], Evalue: 0.00025, Aligned region: 110..132
Protein Sequence: 273 a.a.     [Download]
>gi|332715421|ref|YP_004442887.1| hypothetical protein AGROH133_09379 [Agrobacterium sp. H13-3]
MTLRDEISRLLDDNQLQDAIGLVRDHVKTGPTDKDGRHFYIDLLVLAGDYEKADAQCNLAATFSPQDSVG
FSLFRHQLRAMAARNAWFESGAVPDFPGGPSELDQLAIRANIAARSGDVEGAKDALNELDEKRGNVPIGH
DGKSAGDIRDLDDRVPHALEVLTNGGRYLWIDYGRIESLSIDPMSRPRDLAFRGAELTLRDGAVASVLLP
AIYHGSGDDVGLLLGRETHWSEGEPLITGLGQRCLLIGDDVVPFHEIGALSALSDEERQIARG
 
Nucleotide Sequence: 822 bp     [Download]
>gi|332715374|ref|NC_015508.1|:46979-47800 Agrobacterium sp. H13-3 chromosome linear, complete sequence
ATGACGCTGCGCGACGAAATTTCCCGCCTCCTGGACGACAACCAGCTGCAAGACGCAATCGGGCTCGTGC
GGGACCATGTGAAAACCGGGCCGACCGACAAGGATGGCCGCCATTTCTACATCGATCTGCTGGTCCTCGC
CGGCGACTATGAAAAGGCCGATGCGCAATGCAATCTGGCCGCAACATTCTCACCGCAGGACAGCGTCGGT
TTTTCCCTCTTCCGCCACCAGCTGCGCGCCATGGCCGCACGCAATGCGTGGTTTGAAAGCGGCGCCGTAC
CGGATTTCCCCGGCGGCCCCTCCGAACTTGACCAATTGGCCATCCGGGCGAACATTGCCGCGCGGAGCGG
CGATGTCGAGGGCGCGAAAGACGCGTTGAATGAACTCGACGAAAAACGCGGCAATGTGCCAATCGGCCAC
GACGGCAAGAGCGCCGGCGACATCCGCGATCTGGACGATCGGGTTCCGCATGCGCTGGAAGTCCTGACCA
ACGGCGGACGTTATCTCTGGATCGATTACGGACGCATCGAGAGCCTCAGCATCGACCCCATGAGCCGCCC
GCGCGACCTCGCCTTTCGCGGCGCCGAACTAACGTTGCGCGACGGGGCAGTCGCATCCGTGCTGCTTCCG
GCGATCTATCACGGTTCGGGCGACGATGTCGGTCTCCTCCTCGGTCGGGAAACGCACTGGAGTGAGGGTG
AACCACTGATAACGGGTCTTGGCCAACGCTGCCTGCTGATTGGCGACGATGTTGTGCCGTTCCACGAAAT
CGGCGCGCTTTCCGCCCTGTCCGACGAAGAAAGGCAGATCGCCCGTGGTTGA