SecReT6
Protein ID: 332715422
SecReT6 ID438
T6SS typei5
Gene symbol-
Locus tagAGROH133_09380
StrainAgrobacterium sp. H13-3
Repliconchromosome linear [GenBank: NC_015508] [Browse all T6SS(s) in this replicon]
Location [Strand]47793..48302 [+]
Producthypothetical protein
NoteTssE
UniProt IDF0LDB1
KEGG IDagr:AGROH133_09380
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.00E-18, Aligned region: 42..144
Protein Sequence: 169 a.a.     [Download]
>gi|332715422|ref|YP_004442888.1| hypothetical protein AGROH133_09380 [Agrobacterium sp. H13-3]
MVDPLEQYRARQRTLSRSVLDRLLDDAPDAETDMLVSLKDQAREMREVIRRDLEALLNTRRNPAGPPAAL
KELSDALVSYGVDGILSANLVTDASKARLARSIERRISLFETRLADVHVTILKNRTDGDRALRMRIQASF
RLQEGMPPISFESRIDPSTQQFLVEATNG
 
Nucleotide Sequence: 510 bp     [Download]
>gi|332715374|ref|NC_015508.1|:47793-48302 Agrobacterium sp. H13-3 chromosome linear, complete sequence
GTGGTTGATCCGCTGGAGCAATATCGCGCACGGCAAAGGACGCTGTCGCGCTCGGTTCTGGACCGACTGC
TCGATGACGCGCCGGATGCGGAAACGGATATGCTCGTCAGCCTGAAGGATCAGGCCCGCGAGATGCGCGA
GGTGATCCGCCGCGACCTCGAGGCATTGCTCAATACTCGCCGCAACCCGGCCGGCCCGCCGGCTGCGTTG
AAGGAACTGTCCGATGCCCTCGTAAGCTACGGCGTGGACGGCATTCTTTCAGCCAATCTGGTGACGGATG
CCTCCAAGGCGCGACTCGCTCGCAGCATCGAGCGGCGGATTTCCCTGTTCGAAACACGCCTTGCCGACGT
GCATGTGACGATCCTGAAAAACCGCACGGATGGTGACCGGGCGCTTCGCATGCGCATACAGGCAAGCTTC
CGCCTACAGGAAGGCATGCCGCCGATCAGCTTTGAATCCCGGATCGATCCTTCCACGCAGCAATTCCTGG
TGGAGGCGACGAATGGCTGA