SecReT6
Protein ID: 332715423
SecReT6 ID438
T6SS typei5
Gene symbol-
Locus tagAGROH133_09381
StrainAgrobacterium sp. H13-3
Repliconchromosome linear [GenBank: NC_015508] [Browse all T6SS(s) in this replicon]
Location [Strand]48295..50076 [+]
Producthypothetical protein
NoteTssF
UniProt IDF0LDB2
KEGG IDagr:AGROH133_09381
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.70E-191, Aligned region: 5..593
Protein Sequence: 593 a.a.     [Download]
>gi|332715423|ref|YP_004442889.1| hypothetical protein AGROH133_09381 [Agrobacterium sp. H13-3]
MAEGFLEKYNDELFALRKRASRFAAAFPKIAGRLRMTGDVADDPHVERLIQSFAYSAARVRQKLDDEFPE
LSDSLLETLYPHYLAPIPSMSVVQFAPSPALATVQTLPRHSEILAEPVGGESCRFRTTQDVEIVPLEIAA
ATLTGQPIDAPFSASFAGAASCLRLSLRSTAPRSGTFPEMGLTKLQIFLSAAWQQATALYELLTNHCVGM
ALARHAEDKEAVFLPAGSLTPSGYSRDKAMLPYPANSFDGYRLLTEFFALPQKFLFLDIDGLQKWGGGDC
ELYIYLDAADTRLERMVSVRDFVLNASPVINLFKQSCEPLSLDGTRTEYRLLPDARRQRTREIYAVENVQ
LTSRSGQTEKTSPFFGRTQRNNGANVYWQIQRRFDDDGSSDTDIAFVDQKRGPLGPLDMVASIDTLCLNR
ELPSQLPFGGGHPFLQLSTGNEAVKSIHALMPPTEAIRVNERSAREWRLISHLLLNHLSLTDNGGAPLKD
ILSLYSFRDSPETRQIVEAISNVEAQNSHARIGSAMVPGTDITVEFDPALIARPAAFVFAGVLNHFFGLY
TSINSFTRLTATMRGHSKPIARWPARAADRPLL
 
Nucleotide Sequence: 1782 bp     [Download]
>gi|332715374|ref|NC_015508.1|:48295-50076 Agrobacterium sp. H13-3 chromosome linear, complete sequence
ATGGCTGAAGGCTTCCTCGAAAAGTACAATGACGAGCTTTTTGCGCTGCGAAAGCGCGCATCTCGTTTCG
CGGCGGCGTTTCCGAAGATCGCCGGCAGGCTGCGGATGACGGGCGACGTTGCCGACGATCCGCATGTCGA
GCGTCTGATCCAGAGTTTCGCCTACTCCGCCGCCCGGGTGCGCCAGAAGCTGGATGACGAATTCCCCGAA
CTGTCGGACAGTCTGCTGGAAACGCTCTATCCACATTATCTTGCCCCGATCCCTTCGATGAGCGTCGTGC
AATTCGCTCCGAGCCCGGCGCTGGCAACCGTGCAGACGCTTCCCCGCCACAGCGAAATTCTCGCCGAACC
GGTTGGCGGCGAAAGCTGCCGTTTCCGCACCACGCAGGACGTCGAGATCGTTCCACTGGAGATCGCAGCT
GCCACACTCACCGGTCAGCCGATCGACGCCCCTTTTTCGGCGTCCTTTGCCGGCGCGGCCAGCTGTTTGA
GGCTTTCGCTACGCAGCACGGCCCCGCGCAGCGGTACTTTCCCGGAAATGGGACTGACGAAACTCCAGAT
TTTCCTGTCCGCCGCATGGCAGCAGGCGACAGCGCTTTACGAGCTTTTGACCAACCATTGCGTCGGCATG
GCGCTTGCGCGTCACGCCGAGGACAAGGAAGCCGTTTTCCTGCCCGCCGGAAGTCTTACGCCGTCCGGGT
ACTCTCGCGATAAAGCCATGCTGCCATATCCAGCCAACAGTTTTGATGGATACCGGCTTCTCACCGAATT
CTTCGCGCTGCCGCAGAAATTTCTGTTTCTCGATATTGACGGCCTGCAGAAATGGGGCGGCGGCGACTGC
GAGCTATACATTTATCTGGATGCGGCGGACACGCGGCTTGAGCGCATGGTGTCGGTCAGAGATTTTGTGT
TGAACGCCTCACCGGTGATCAACCTGTTCAAACAAAGTTGCGAACCGCTCAGTCTTGATGGTACGCGGAC
GGAATACAGGTTGCTGCCGGATGCACGGCGGCAGCGGACGCGCGAGATCTATGCCGTTGAAAACGTTCAA
CTGACCAGCCGTTCCGGACAGACCGAGAAGACGTCTCCGTTTTTTGGTCGCACACAGCGCAATAATGGCG
CAAACGTTTACTGGCAGATACAGCGCCGGTTCGATGATGACGGCTCTTCCGATACGGACATCGCCTTCGT
GGATCAGAAGCGCGGCCCGCTTGGGCCGCTCGACATGGTGGCAAGCATTGATACACTTTGCCTCAACCGC
GAACTGCCAAGCCAGCTTCCCTTTGGCGGCGGGCACCCATTCCTGCAACTTTCTACCGGCAACGAGGCGG
TGAAATCCATCCATGCGCTGATGCCGCCGACGGAGGCGATCCGCGTCAACGAGCGTTCGGCACGCGAGTG
GCGGCTGATCTCACATCTTCTCCTCAACCATCTCTCGCTCACCGACAACGGCGGCGCGCCGCTGAAGGAC
ATTCTCTCGCTTTATTCCTTCAGGGACAGCCCGGAAACCAGACAGATCGTAGAGGCGATCAGCAATGTCG
AGGCGCAGAATTCTCATGCCCGGATTGGCTCGGCAATGGTACCGGGAACAGATATCACGGTGGAGTTTGA
CCCGGCACTGATCGCGCGACCTGCCGCATTTGTTTTCGCCGGCGTCCTCAACCATTTCTTCGGGCTCTAC
ACCTCGATCAACAGTTTCACGCGACTGACGGCGACGATGCGAGGCCACTCCAAACCGATTGCCCGCTGGC
CAGCCCGCGCGGCCGACCGGCCGCTGCTTTAG