SecReT6
Protein ID: 332715424
SecReT6 ID438
T6SS typei5
Gene symbol-
Locus tagAGROH133_09382
StrainAgrobacterium sp. H13-3
Repliconchromosome linear [GenBank: NC_015508] [Browse all T6SS(s) in this replicon]
Location [Strand]50086..51090 [+]
Producthypothetical protein
NoteTssG
UniProt IDF0LDB3
KEGG IDagr:AGROH133_09382
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.40E-66, Aligned region: 37..310
Protein Sequence: 334 a.a.     [Download]
>gi|332715424|ref|YP_004442890.1| hypothetical protein AGROH133_09382 [Agrobacterium sp. H13-3]
MEQQTPTIKDRQAALLSNDPGRFDPATAFRVAQFVSADDGIVIGAHGGIQPTPLAVSGFSRKRGHAELKS
AFAPIVGPLGSLPPAYGELLQREERNRSGALASFFNLFAARFSELFVSATEKYRLARGLRWSADQRDNGF
RKTLLALIGFRTAGLVEKAGVSEDALLRFSGLLAGRNRNVSALTSMLCEFTGLPVHIEQFRRRWVALPLH
EQSQLGQASGLRLGQNSTAGSAVEDMSGGFRVVIGPVAYADYLALTPGSKRLAEIFSLTRLFVGSALHFD
VQVILKKEDIPFCRLGQSDAPARLGWNSWARVAPAQQDSADAVVTEREGSAISA
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|332715374|ref|NC_015508.1|:50086-51090 Agrobacterium sp. H13-3 chromosome linear, complete sequence
ATGGAACAGCAGACGCCAACCATCAAAGACAGACAGGCGGCGCTTCTCAGCAACGATCCCGGCCGTTTTG
ACCCTGCAACCGCGTTTCGCGTCGCCCAGTTCGTTTCGGCGGATGACGGGATCGTCATCGGCGCCCATGG
TGGAATACAGCCGACACCGCTTGCAGTCAGCGGTTTCAGCCGCAAGCGCGGTCATGCCGAACTGAAATCA
GCTTTCGCGCCCATCGTCGGCCCGCTTGGTTCGCTACCGCCGGCATACGGCGAACTGCTGCAACGGGAAG
AACGCAATCGTTCGGGCGCGCTGGCCAGCTTCTTCAACCTTTTTGCGGCAAGGTTCAGCGAGCTGTTTGT
ATCCGCGACGGAAAAATACCGTCTTGCAAGGGGTTTGCGCTGGTCGGCCGATCAGAGGGACAACGGTTTC
CGCAAAACACTGCTCGCCCTCATCGGGTTCCGCACTGCCGGTCTGGTCGAGAAAGCAGGCGTGAGCGAAG
ACGCGCTCCTGCGTTTCAGCGGTCTTCTGGCCGGCCGCAACCGCAATGTTTCGGCCCTGACATCAATGCT
TTGCGAATTCACGGGACTTCCGGTCCATATCGAACAGTTTCGCCGGCGTTGGGTGGCTTTACCGCTTCAC
GAACAAAGCCAGCTGGGGCAGGCATCAGGACTGAGGCTCGGACAGAACTCGACAGCGGGAAGCGCTGTCG
AAGATATGAGCGGCGGCTTCCGGGTCGTGATCGGCCCTGTCGCATATGCGGATTACCTTGCCCTCACGCC
CGGTTCGAAACGGCTTGCGGAAATATTTTCTCTGACACGCCTGTTCGTCGGAAGCGCATTGCACTTCGAT
GTGCAGGTGATCCTGAAAAAGGAGGACATTCCCTTTTGCCGCCTCGGCCAGTCCGATGCTCCCGCCCGTC
TCGGCTGGAACAGCTGGGCTCGCGTGGCACCCGCCCAACAAGACAGCGCTGACGCTGTGGTGACCGAGCG
GGAAGGCTCGGCGATTTCCGCGTGA