SecReT6
Protein ID: 332715425
SecReT6 ID438
T6SS typei5
Gene symbol-
Locus tagAGROH133_09383
StrainAgrobacterium sp. H13-3
Repliconchromosome linear [GenBank: NC_015508] [Browse all T6SS(s) in this replicon]
Location [Strand]51097..52302 [+]
Productputative forkhead-type phosphopeptide-binding protein
NoteFha
UniProt IDF0LDB4
KEGG IDagr:AGROH133_09383
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 7.30E-17, Aligned region: 29..95
Protein Sequence: 401 a.a.     [Download]
>gi|332715425|ref|YP_004442891.1| putative forkhead-type phosphopeptide-binding protein [Agrobacterium sp. H13-3]
MDMKLALKDTRNIGAARASQWTFERGRRVIGRSRECDWQIDDNERRVSKLHCTLNRDGEGFTIMDQSANG
TLVDGRLLLEGESARLRDGSQINIGGQVFQVAISGDAELDFSDPDASLRISDEPLTISAILADIAPNGRS
AGGMMGNTASVDDWSETWREGAKRKAKSISRNVEIGWSEPPAAHGISAILPDNWDEEPVASSEHEHTDAL
NTPVMISRPVSAARSEDFDNVFPETEENLRVENASAAGVSTAPEIGDLLTTLEQESADCLAVLDLESEHA
GQGSSASLSERMERLIRQQRQLAYALETLIHGCTQRLEPRFIEASVDAGNDFRAKIGRRDWQGLIIKTDY
WSAYKKQFEENGRPLPVRQFLQRAARGEAAPVRQTDAATADAKGVNDHDET
 
Nucleotide Sequence: 1206 bp     [Download]
>gi|332715374|ref|NC_015508.1|:51097-52302 Agrobacterium sp. H13-3 chromosome linear, complete sequence
ATGGATATGAAGCTTGCACTCAAGGACACACGCAATATCGGAGCAGCAAGAGCCAGTCAGTGGACCTTCG
AGCGCGGCCGCCGCGTCATTGGCCGTTCGCGGGAATGCGACTGGCAGATCGACGACAATGAACGGCGCGT
TTCCAAGCTGCACTGTACACTCAACCGCGATGGCGAAGGCTTCACGATAATGGACCAGAGCGCGAATGGC
ACGCTGGTCGATGGCCGCCTTCTGCTCGAAGGCGAAAGCGCACGTCTCCGCGACGGTTCGCAAATCAACA
TTGGCGGGCAGGTTTTTCAGGTCGCCATCAGCGGCGATGCCGAACTGGATTTTTCCGACCCCGACGCATC
CCTGCGAATAAGCGACGAGCCGCTGACCATTTCGGCGATCCTTGCGGACATCGCCCCGAACGGCCGTTCG
GCCGGCGGCATGATGGGCAACACTGCCTCTGTCGACGACTGGTCCGAAACATGGCGGGAGGGCGCCAAAC
GGAAGGCGAAATCCATTTCGCGAAATGTCGAGATCGGCTGGAGCGAACCGCCCGCGGCGCATGGAATAAG
TGCCATTCTTCCTGATAACTGGGATGAGGAGCCGGTTGCAAGCAGCGAGCACGAACATACCGACGCGCTA
AACACGCCCGTCATGATCTCTCGCCCGGTTTCGGCCGCCCGCAGCGAAGATTTCGACAATGTTTTCCCGG
AGACAGAAGAAAACTTACGAGTGGAAAACGCATCGGCTGCAGGCGTTTCTACCGCGCCGGAGATTGGTGA
TCTTCTAACCACGCTGGAGCAGGAAAGCGCCGATTGTCTAGCCGTTCTCGACCTCGAGAGCGAGCACGCT
GGCCAAGGTTCGTCAGCCTCCCTGAGCGAGCGGATGGAAAGGCTCATCCGCCAGCAGCGGCAACTTGCCT
ACGCGCTCGAAACTTTGATCCATGGTTGCACGCAAAGGCTCGAGCCGAGGTTTATCGAGGCGTCTGTCGA
TGCCGGCAACGATTTCCGGGCAAAGATCGGCCGCCGGGACTGGCAGGGGCTGATCATCAAAACAGACTAC
TGGTCCGCCTACAAAAAGCAATTCGAAGAAAACGGCCGTCCATTGCCGGTCAGGCAGTTCCTGCAGCGCG
CAGCGCGTGGTGAAGCCGCGCCGGTACGGCAGACTGACGCGGCCACAGCCGATGCCAAGGGGGTAAATGA
CCACGATGAGACATGA