SecReT6
Protein ID: 332715426
SecReT6 ID438
T6SS typei5
Gene symbol-
Locus tagAGROH133_09384
StrainAgrobacterium sp. H13-3
Repliconchromosome linear [GenBank: NC_015508] [Browse all T6SS(s) in this replicon]
Location [Strand]52292..53632 [+]
Producthypothetical protein
NoteTssK
UniProt IDF0LDB5
KEGG IDagr:AGROH133_09384
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.70E-156, Aligned region: 19..445
Protein Sequence: 446 a.a.     [Download]
>gi|332715426|ref|YP_004442892.1| hypothetical protein AGROH133_09384 [Agrobacterium sp. H13-3]
MRHENRVAWSEGMFLRVQHFQQSDRWTERLVRNTTRNLSPYPWGIVEIGVDRSALSIGQFALSNLRGILP
DGTPFEAPEDSDLPPPLDLDESVKNAIIYLALPARQPGKADMSASGHNDTNNVRFTASTYEVSDTNMETD
FVAPIDVGRLSLKFLKTGDDLSGYELIGLARVIEVRSDRAVILDPDFIPPSLSCAAAPRLNELLTELLGI
VRHRAQAIAERIGDPTIRGTAEVGDYFLLQILNRADPLLAHRCANATRFHPIRFYEDCIQLAGELATFTT
DRKRATDFPPYRHDDLKATFGAVFDDLRTSLSAVLEQAAVAIELVERRHGVRVGTIHDRTLLRDAGFVLA
VRADMAAEDIRRRLPAQIKVGPVERISELVNVALPGIPVRSLPVLPRQLPYRSGTVYFEIDTQSPLWKQL
DTSGAIALHLAGEFPGLEMEMWALRE
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|332715374|ref|NC_015508.1|:52292-53632 Agrobacterium sp. H13-3 chromosome linear, complete sequence
ATGAGACATGAGAACCGTGTAGCCTGGAGCGAGGGCATGTTTCTTCGCGTCCAGCATTTTCAGCAGTCCG
ACCGTTGGACCGAACGCCTGGTGCGCAACACCACACGCAACCTTTCGCCCTATCCGTGGGGGATCGTTGA
GATCGGGGTCGATCGCAGCGCCTTGTCGATAGGGCAATTCGCTCTGTCGAACCTGCGCGGCATCCTTCCC
GACGGCACGCCCTTCGAGGCGCCTGAGGATTCCGACCTGCCGCCGCCGCTCGATCTCGACGAAAGCGTCA
AAAATGCCATCATCTATCTCGCCCTGCCGGCCCGGCAGCCGGGTAAGGCCGACATGTCCGCCAGCGGCCA
CAACGACACCAACAATGTGCGTTTCACCGCATCCACCTATGAAGTCTCCGATACCAATATGGAGACGGAT
TTCGTGGCCCCGATTGATGTCGGCCGCCTGAGCCTGAAGTTCCTCAAGACCGGTGACGATCTTTCCGGTT
ATGAACTCATCGGGCTGGCGCGGGTAATCGAAGTCCGCTCCGACCGTGCGGTCATTCTCGATCCTGATTT
CATCCCTCCAAGCCTCAGCTGCGCGGCAGCGCCCCGTCTCAACGAATTGCTGACGGAGCTTCTTGGGATC
GTGCGCCACCGCGCCCAGGCGATCGCCGAACGCATCGGTGATCCGACGATCCGGGGGACGGCGGAAGTGG
GCGATTATTTCCTGCTGCAGATCCTCAACCGGGCCGATCCGCTACTGGCGCATCGCTGTGCCAACGCTAC
GCGTTTTCATCCCATCCGCTTTTACGAAGACTGCATCCAGCTTGCCGGCGAGCTCGCCACCTTCACCACG
GATAGAAAGCGGGCGACAGATTTCCCGCCCTATCGACACGACGATCTGAAAGCCACCTTCGGCGCTGTGT
TTGATGATCTGCGTACCTCGCTGTCTGCGGTTCTGGAACAGGCGGCCGTCGCAATCGAACTGGTGGAACG
CCGTCATGGCGTCCGCGTCGGCACTATCCACGACCGCACGCTTCTGCGCGACGCCGGCTTCGTGCTTGCC
GTGCGGGCGGATATGGCTGCCGAGGATATTCGCCGCCGCCTGCCGGCACAGATCAAGGTCGGTCCGGTGG
AACGGATTTCCGAACTGGTTAATGTGGCACTGCCGGGTATTCCCGTGCGGTCCCTGCCGGTTCTGCCGCG
GCAACTACCCTATCGATCCGGCACCGTTTATTTCGAGATCGACACGCAGTCGCCGCTCTGGAAACAGCTC
GATACTTCAGGGGCGATTGCCCTGCATCTGGCGGGAGAATTTCCCGGGCTTGAAATGGAAATGTGGGCAT
TACGCGAATGA