SecReT6
Protein ID: 332715427
SecReT6 ID438
T6SS typei5
Gene symbol-
Locus tagAGROH133_09385
StrainAgrobacterium sp. H13-3
Repliconchromosome linear [GenBank: NC_015508] [Browse all T6SS(s) in this replicon]
Location [Strand]53629..55140 [+]
ProductOmpA-like porin
NoteTssL
UniProt IDF0LDB6
KEGG IDagr:AGROH133_09385
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.40E-58, Aligned region: 74..278
OmpA [PF00691], Evalue: 6.50E-14, Aligned region: 369..466
Protein Sequence: 503 a.a.     [Download]
>gi|332715427|ref|YP_004442893.1| OmpA-like porin [Agrobacterium sp. H13-3]
MSTENPSSWQDLPTVVEITEESRRRNQNARNMAAILEDIVETDEPAGPSRAKATAMPVEQLLTGFHFGGE
EVPTLVQSAAPLLNLAHLLRFSDAEPDPDQLRRACVEAITRYERDLASARISPERARAAHYVVCATVDDV
VLSKPWGVRAGWARSGLVSTFHNDVTGGDRVFDILDHFHQSPGTNKDLLLLIYLCLSLAFEGRTRVSPKG
ALELSRIRDSLYKTLIGQYGAFERELSPHWKGVDARHTPLRAMAALWTMLSLMALAFALGYLFFTLSLNS
ASDVTFERLAHLPPNETPSVLIASPPAPTPPPTRVETPRVVDPPKIVEPRQPSRLEKLMAFLQPEVDRKL
VTLADVNGRLRVRINNSGLFTTGSADVSPQFRDLIQRIGGALAAEKFRAVVIGYTDTVPIKTVEFPSNWH
LSEARAKAVGDILSQFTGPEAILTEGRADSDPIADNKTEEGRQINRRTEIMVLTNPDEKLSDAGILSPPI
QNSPGQQPGETQP
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|332715374|ref|NC_015508.1|:53629-55140 Agrobacterium sp. H13-3 chromosome linear, complete sequence
ATGAGCACGGAAAACCCCTCTTCCTGGCAAGACTTGCCAACGGTGGTCGAGATCACCGAGGAAAGTCGCC
GGCGCAACCAGAACGCCCGCAACATGGCGGCAATCCTGGAGGACATCGTCGAGACCGACGAGCCGGCAGG
CCCCAGCAGGGCAAAGGCGACTGCCATGCCGGTCGAACAGCTGCTGACCGGTTTCCACTTCGGCGGCGAG
GAGGTTCCGACACTTGTGCAATCGGCAGCTCCCCTTCTCAACCTCGCACATCTGCTGCGCTTCAGCGATG
CCGAGCCGGATCCCGACCAGCTTCGCCGCGCCTGCGTTGAAGCAATTACACGCTATGAACGCGACCTCGC
CTCCGCCCGCATTAGCCCCGAGCGGGCAAGGGCTGCGCATTATGTCGTCTGCGCGACGGTCGATGACGTC
GTTCTCAGCAAGCCTTGGGGTGTGCGGGCAGGCTGGGCGCGCTCCGGGCTCGTTTCCACGTTCCACAATG
ACGTCACTGGCGGCGACCGGGTTTTCGACATTCTCGACCATTTCCACCAGTCGCCCGGCACCAACAAGGA
TCTGCTGCTTCTGATCTATCTGTGCTTGTCGCTGGCTTTCGAAGGACGAACCCGCGTTTCACCGAAAGGA
GCGCTCGAGCTTTCACGCATCCGCGACAGCCTCTACAAAACGCTGATCGGCCAATATGGCGCCTTCGAAC
GGGAGCTTTCTCCGCATTGGAAAGGTGTCGATGCCCGACATACGCCATTGCGCGCGATGGCGGCGCTCTG
GACCATGCTGTCGCTGATGGCGCTCGCCTTCGCGCTCGGTTATCTCTTCTTCACGCTGTCGCTCAACAGC
GCATCCGATGTCACCTTCGAAAGACTTGCTCATCTGCCGCCGAACGAAACACCGAGCGTGTTGATCGCAA
GCCCTCCTGCACCAACGCCGCCGCCAACTAGAGTGGAAACTCCCCGCGTCGTTGATCCACCCAAAATCGT
GGAGCCGAGACAACCCTCCCGGCTTGAAAAGCTGATGGCCTTCCTGCAGCCAGAAGTCGACAGGAAGCTC
GTGACCCTTGCGGATGTGAACGGGCGGCTGCGGGTTCGCATCAACAATTCGGGCCTGTTCACGACAGGCA
GCGCCGATGTCAGCCCGCAGTTCCGCGATCTCATCCAGCGTATCGGCGGCGCGCTTGCGGCTGAGAAATT
TCGTGCGGTGGTCATCGGTTATACCGACACCGTGCCGATCAAGACGGTGGAGTTTCCATCGAACTGGCAC
CTTTCCGAGGCGCGCGCCAAGGCCGTTGGAGACATTCTTTCCCAATTCACCGGTCCTGAGGCAATCCTGA
CCGAAGGCCGGGCCGACAGCGACCCGATCGCCGACAACAAGACGGAAGAAGGCCGTCAGATAAACCGCAG
AACAGAAATCATGGTCCTGACCAATCCCGATGAAAAACTGAGCGATGCCGGCATTCTCTCGCCGCCCATA
CAGAACAGTCCGGGACAGCAGCCGGGAGAGACCCAGCCATGA