SecReT6
Protein ID: 333898449
SecReT6 ID439
T6SS typei3
Gene symbol-
Locus tagPsefu_0244
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T6SS(s) in this replicon]
Location [Strand]274038..276110 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDF6AF30
KEGG IDpfv:Psefu_0244
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.10E-87, Aligned region: 32..330
Phage_base_V [PF04717], Evalue: 2.00E-25, Aligned region: 370..463
Gp5_C [PF06715], Evalue: 6.40E-07, Aligned region: 515..536
Gp5_C [PF06715], Evalue: 6.40E-07, Aligned region: 522..545
Gp5_C [PF06715], Evalue: 6.40E-07, Aligned region: 548..569
Gp5_C [PF06715], Evalue: 6.40E-07, Aligned region: 611..624
DUF2345 [PF10106], Evalue: 3.10E-05, Aligned region: 646..684
Protein Sequence: 690 a.a.     [Download]
>gi|333898449|ref|YP_004472322.1| ImpA family type VI secretion-associated protein [Pseudomonas fulva 12-X]
MMAITQAARMAVITSPLGGDTLVLERLEGHDELGRPFSHELALISEDDGLSLDALLGKPMGLAVQLADGS
DRYFHGIVARCSQTAHRGQFASYQVTLKPWLWLLSRTSDCRIFQSKTVPEIIKQVFRDLGFSDFEDALTR
SYREWEYCVQYRETSLDFVSRLMEQEGIYYYFRHEKSRHVLVLCDAYGAHHAAPGYASVPFYPLDDQMRE
RDHIHDWRMAREVQPGSLELNDYDFQRPSARLEVRSSIARPHSNADYPLYDYPGEYVQSKDGEQYARNRI
EAIQTQHERVQLKTNARGLGAGNLFSMTGYPREDQNREYLIVAADYLITQERYESGGDSVAFQFASALTC
IDAGQVFRPLPLTAQPIVQGPQTAMVVGPRDEEIWTDQYGRVKVHFYWDRHDQSNENSSCWIRVSQNWAG
KNWGAIQIPRIGQEVIVSFLEGDPDRPIVTGRVYNAEQTVPYDLPANATQSGVKSRSSKGGTPANFNEIR
MEDKKGEEQLFIHAEKNQDIEVENDETHWVGHDRSKTIDNDETVKVKRDRTETVDRHETITVHGNRSKTV
DKNETVKIGMNKSETILMASLQNVGMGRMENVGLGYSLNVGMMMNTLVGLNQSTQVAKKKTTSVGEQYAI
SVGGKEEGSSVTLDGKSIRLGAQTIELTADQEIRLSCGQSTIRITAGEIEILSPKVDINC
 
Nucleotide Sequence: 2073 bp     [Download]
>gi|333898208|ref|NC_015556.1|:c276110-274038 Pseudomonas fulva 12-X chromosome, complete genome
ATGATGGCAATCACCCAGGCAGCCCGCATGGCGGTGATCACCAGCCCGCTGGGCGGTGACACCCTGGTAC
TGGAGCGGCTCGAGGGCCACGACGAACTGGGTCGGCCATTCAGTCATGAGCTGGCGCTGATTTCGGAAGA
CGACGGCCTGTCGCTGGATGCGTTGCTCGGCAAGCCCATGGGCCTGGCCGTGCAGTTGGCAGACGGCAGC
GACCGCTACTTCCACGGCATCGTCGCCCGCTGCAGCCAGACCGCTCACCGCGGCCAGTTCGCCAGCTATC
AGGTGACGCTCAAGCCCTGGCTATGGCTGCTGTCGCGCACCTCCGACTGCCGCATCTTCCAGAGCAAGAC
GGTGCCGGAGATCATCAAGCAGGTGTTCCGCGACCTGGGCTTCTCCGACTTCGAAGACGCCCTGACCCGC
TCCTACCGCGAGTGGGAGTACTGCGTGCAGTACCGCGAGACCAGCCTGGACTTCGTCAGCCGGCTGATGG
AGCAGGAAGGCATCTACTACTACTTCCGCCACGAGAAATCCCGTCACGTGCTGGTGCTCTGCGATGCCTA
CGGCGCGCACCACGCGGCGCCCGGTTATGCCAGCGTGCCCTTCTATCCGCTCGACGATCAGATGCGCGAG
CGCGACCACATACACGACTGGCGCATGGCGCGCGAGGTGCAGCCGGGCTCACTGGAACTCAACGACTACG
ACTTCCAGCGCCCCAGTGCGCGCCTCGAGGTGCGTTCCAGCATCGCCCGCCCGCACAGCAATGCCGACTA
CCCGCTCTACGACTACCCGGGCGAATACGTGCAGAGCAAGGACGGCGAGCAGTACGCGCGCAATCGCATC
GAGGCGATTCAGACACAACACGAGCGGGTGCAACTGAAAACCAACGCCCGGGGCCTCGGCGCCGGCAACC
TGTTCAGCATGACCGGTTACCCGCGCGAGGATCAGAACCGCGAGTACCTGATCGTGGCCGCCGACTACCT
GATCACCCAGGAGCGTTACGAGAGCGGCGGCGACAGCGTGGCGTTCCAGTTCGCCAGCGCACTGACCTGC
ATCGACGCCGGCCAGGTATTCCGCCCGCTGCCGCTGACCGCACAGCCCATCGTGCAGGGCCCGCAAACGG
CCATGGTGGTCGGCCCCAGGGACGAAGAAATCTGGACCGATCAATACGGCCGCGTGAAGGTGCACTTCTA
TTGGGACCGCCACGACCAGTCCAACGAGAACAGCTCCTGCTGGATTCGCGTGTCGCAGAACTGGGCCGGC
AAGAACTGGGGCGCGATCCAGATTCCGCGCATCGGCCAGGAAGTGATCGTCAGCTTTCTGGAAGGCGACC
CCGACCGACCGATCGTCACCGGCCGCGTTTACAACGCCGAGCAGACGGTGCCCTACGACCTGCCCGCCAA
CGCCACCCAGAGCGGGGTGAAAAGCCGTTCCAGCAAGGGCGGTACGCCAGCAAACTTCAACGAAATCCGC
ATGGAAGACAAGAAGGGCGAAGAGCAGCTGTTCATCCATGCCGAAAAGAACCAGGACATCGAGGTCGAGA
ACGACGAGACCCACTGGGTCGGCCACGACCGCAGCAAGACCATCGACAACGACGAGACCGTGAAGGTCAA
GCGTGATCGCACGGAGACCGTGGATCGCCACGAAACCATCACCGTGCACGGCAACCGCAGCAAGACGGTG
GACAAGAACGAGACGGTCAAGATTGGCATGAACAAGTCCGAGACCATCCTCATGGCCTCGCTGCAGAACG
TCGGCATGGGGCGCATGGAAAACGTCGGCCTGGGCTACAGCCTCAACGTCGGCATGATGATGAACACCCT
GGTGGGCCTTAACCAGAGCACCCAGGTGGCCAAGAAGAAAACCACCTCGGTGGGCGAACAGTACGCCATC
AGTGTCGGAGGCAAGGAAGAAGGCTCCAGCGTCACCCTGGACGGCAAGAGCATCCGCCTGGGCGCCCAGA
CCATCGAGCTGACCGCAGACCAGGAAATCCGCCTGAGCTGCGGGCAGAGCACCATCCGCATCACCGCCGG
CGAGATCGAGATTCTCTCGCCGAAGGTGGATATCAACTGCTGA